[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD98951.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b67A1.bssp"
#ERROR : Can't open dsspfile "1vfrA.bssp"
#ERROR : Can't open dsspfile "1noxA.bssp"
#ERROR : Can't open dsspfile "1ds7A.bssp"
#ERROR : Can't open dsspfile "2ifaA1.bssp"
#ERROR : Can't open dsspfile "1ywqA1.bssp"
#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "1zchA1.bssp"
#ERROR : Can't open dsspfile "2freA1.bssp"
#ERROR : Can't open dsspfile "1vkwA.bssp"

## Summary of PDB Search
:214
    4e-42  26%  2b67A1 [d.90.1.1] COG0778: NITROREDUCTASE A:1 -- 201
    5e-36  19%  1vfrA  [d.90.1.1] NAD(P)H\:FMN OXIDOREDUCTASE
    2e-31  24%  1noxA  [d.90.1.1] NADH OXIDASE
    4e-31  24%  1ds7A  [d.90.1.1] FMN-DEPENDENT NITROREDUCTASE
    4e-30  16%  2ifaA1 [d.90.1.1] HYPOTHETICAL PROTEIN SMU.260 A:2 -- 200
    2e-29  15%  1ywqA1 [d.90.1.1] NITROREDUCTASE FAMILY PROTEIN A:2 -- 200
    8e-27  25%  1bkjA  [d.90.1.1] NADPH-FLAVIN OXIDOREDUCTASE
    3e-22  22%  1zchA1 [d.90.1.1] HYPOTHETICAL OXIDOREDUCTASE YCND A:1 -- 249
    7e-21  22%  2freA1 [d.90.1.1] NAD(P)H-FLAVIN OXIDOREDUCTASE A:1 -- 200
    1e-19   9%  1vkwA  [d.90.1.2] PUTATIVE NITROREDUCTASE
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
2b67A1          --------FLELNKKRHATKHFTDK-LVDPKDVRTAIEIATLAPSAHNSQPWKFVVVR--EKNAELAKLA
1vfrA           ------HPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSF
1noxA           ------LDAKTAALKRRSIRRYRKD-PVPEGLLREILEAALRAPSAWNLQPWRIVVVRDPATKRALREAA
1ds7A           -------DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
2ifaA1          ------SNFLDLQKQRRSIYALGKTVDLSKAELVALIQNAIQAPSAFNSQTSRALVLFGQDSQDFWN-KI
1ywqA1          ------TNLKEAIVNRRSIRKVTKNDAITKERIEEVLKTALHAPTSFNMQSGRMVVLMDGEHEKFWD--I
1bkjA           ------NNTIETILAHRSIRKFT-AVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELA--Q
1zchA1          ------NEVIKSLTDHRSIRSYTDE-PVAQEQLDQIIEAVQSAPSSINGQQVTVITVQDKERKKKISEL-
2freA1          ---------DPLFLDRWSPRAFDGS-PXPKEHLLTILDAAHWAPSASNHQPWRFVYAKDSEDWPLFVELL
1vkwA           -------NIFEAIENRHSVRDFLER-KXPERVKDDIENLLVKFITKKLDWKINLSSFPSYIYAKAEKH--


                         .         .         *         .         .         .         .:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
2b67A1          YGSNFEQVSSAPVTIALFTDTDLAKRARKIAR-VGGANNFSEEQLQYFXKNLPAEFARYSEQQVSDYLAL
1vfrA           HQFNQPHIKACSHVILFANKLSYTRDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKATKP
1noxA           --FGQAHVEEAPVVLVLYADLEDALAH----LDEVIHPGVQGERREAQKQAIQRAFAAMGQEARKAWASG
1ds7A           YVFNERKMLDASHVVVFCAKTAMDDVWKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDMAK
2ifaA1          AYSELEKVTPAEAFAGTKAKL----------ESFAAGVGTILLFEDQAVVRNLEENFPLYAENFQPWSEQ
1ywqA1          VKETLRARVPAENFEATVE------RLKGFHAGVGTVLFFEDQATVEKMQENAPLYKDQFPF----WSHQ
1bkjA           FAGNQAYVESAAEFLVFCIDYQRH-------ATINPDVQADFTELTLI-------------------GAV
1zchA1          -AGGQPWIDQAPVFLLFCAD-------FNRAKIALEDLHDFKMEIT----------NGLESVLV---GAV
2freA1          XEGNQKWAKNASVLLFVISRD-------------------------------HTISHEGEKKPSATHSF-
1vkwA           FDELVEYGFQGEQIVLFLTAQG-FGTCWXARSPHPDVPYIIVFGYPRTRNFTRKRRPITSFLENDLEELP


                         +         .         .         .         .         *         .:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
2b67A1          NAGLVAXNLVLALTDQGIGSNIILGFDKSKVNEVLEI-EDRFRPELLITVGYTDEKLE--PSYRLPVDEI
1vfrA           QAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEASLPKSRKAFEDV
1noxA           QSYILLGYLLLLLEAYGLGSVPMLGFDPERVRAILGL-PSRAAIPALVALGYPAEEGY--PSHRLPLERV
1ds7A           QVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDATLPKSRLPQNIT
2ifaA1          AHGIALYAIWLALAEQNISVQHYNPLVDAQVAEKYDL-PTNWKXRAQIPFGSIEAPAG--EKEFXADQER
1ywqA1          GNAMLQHTVWMLLSAEGIGASLQNPIVDAEVKETWNI-PAEWSLVGQMPFGEPNEQPA--ERTFLPTEDV
1bkjA           DSGIMAQNCLLAAESMGLGGVYIGGLSAAQVDELLGL-PENSAVLFGMCLGHPDQNPE--VKPRLPAHVV
1zchA1          DAGIALGTATAAAESLGLGTVPIGAGNPQELIELLEL-PKYVFPLSGLVIGHPADRSA--KKPRLPQEAV
2freA1          DAGAAWFSLAXQAHLLGYHAHGXGGIFKDRIVEKLDI-PDGFKVEAGVAIGTLTDKSI------------
1vkwA           PEIVKIVEXTILAPSALNRQPKIKYTGGELCISSERP-VDLGIALSHAYLT-------------------


                         .         .         .         +         .         .         .:280
query           IEFQ
2b67A1          IE--
1vfrA           ITI-
1noxA           VLWR
1ds7A           LTE-
2ifaA1          FKV-
1ywqA1          VKF-
1bkjA           V---
1zchA1          NHQ-
2freA1          ----
1vkwA           ----