[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99160.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs6Z1.bssp"
#ERROR : Can't open dsspfile "2hgj31.bssp"

## Summary of PDB Search
:82
    6e-22  40%  1vs6Z1 [d.325.1.2] 50S RIBOSOMAL PROTEIN L31 Z:1 -- 70
    3e-16  43%  2hgj31 [d.325.1.2] 50S RIBOSOMAL PROTEIN L31 3:1 -- 50
:82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
1vs6Z1          MKKDIHPKYEEITASCS-CGNVMKIRSTVGHD-------------LNLDVCSKCHPFFTGKQRDVATGGR
2hgj31          MKEGIHPKLVPARIICGCGN---------------VIETYSTKPEIYVEVCSKCHPFYTGQQRF------


                         .         .         *         .         .         .         .:140
query           VDRFNKKYGxxx
1vs6Z1          VDRFNKRFN---
2hgj31          ------------