[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99233.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fv7A1.bssp"
#ERROR : Can't open dsspfile "1gqtA.bssp"
#ERROR : Can't open dsspfile "2afbA1.bssp"
#ERROR : Can't open dsspfile "1v19A.bssp"
#ERROR : Can't open dsspfile "1wyeA1.bssp"
#ERROR : Can't open dsspfile "2abqA1.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "1tyyA.bssp"
#ERROR : Can't open dsspfile "1vk4A.bssp"
#ERROR : Can't open dsspfile "2awdA1.bssp"
#ERROR : Can't open dsspfile "1dgmA.bssp"
#ERROR : Can't open dsspfile "1td2A.bssp"
#ERROR : Can't open dsspfile "2ajrA1.bssp"
#ERROR : Can't open dsspfile "1kyhA.bssp"
#ERROR : Can't open dsspfile "1jxhA.bssp"
#ERROR : Can't open dsspfile "1lhpA.bssp"
#ERROR : Can't open dsspfile "1c3qA1.bssp"

## Summary of PDB Search
:307
    2e-75  36%  2fv7A1 [c.72.1.1] RIBOKINASE A:15 -- 322
    4e-68  41%  1gqtA  [c.72.1.1] RIBOKINASE
    2e-52  22%  2afbA1 [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE A:-2 -- 330
    2e-51  20%  1v19A  [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-47  21%  1wyeA1 [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE A:2 -- 309
    4e-47  20%  2abqA1 [c.72.1.1] FRUCTOSE 1-PHOSPHATE KINASE A:1 -- 306
    2e-44  22%  1bx4A  [c.72.1.1] PROTEIN (ADENOSINE KINASE)
    9e-43  22%  1tyyA  [c.72.1.1] PUTATIVE SUGAR KINASE
    3e-36  16%  1vk4A  [c.72.1.1] PFKB CARBOHYDRATE KINASE TM0415
    5e-35  22%  2awdA1 [c.72.1.1] TAGATOSE-6-PHOSPHATE KINASE A:1 -- 313
    5e-33  22%  1dgmA  [c.72.1.1] ADENOSINE KINASE
    7e-31  16%  1td2A  [c.72.1.5] PYRIDOXAMINE KINASE
    2e-29  18%  2ajrA1 [c.72.1.1] SUGAR KINASE, PFKB FAMILY A:1 -- 319
    2e-28  13%  1kyhA  [c.72.1.4] HYPOTHETICAL 29.9 KDA PROTEIN IN SIGY-CYDD
    7e-24  17%  1jxhA  [c.72.1.2] PHOSPHOMETHYLPYRIMIDINE KINASE
    1e-19  25%  1lhpA  [c.72.1.5] PYRIDOXAL KINASE
    6e-16  17%  1c3qA1 [c.72.1.2] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE) A:1 -- 272
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
2fv7A1          ---AVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGND
1gqtA           -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
2afbA1          ---KVVTFGEIXLRLSP-----PDHKRIFQTDSFDVTYGGAEANVAAFLAQXGLDAYFVTKLPNNPLGDA
1v19A           ---EVVTAGEPLVALVP-----QEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAM
1wyeA1          ---KLITLGEILIEFNA-----LSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYN
2abqA1          ----YTVTLNPSIDYIVQVENFQ-QGVVNRSERDRKQPGGKGINVSRVLKRLGHETKALGFLGGF-TGAY
1bx4A           -----------NDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQQPHKAATFFGCIGIDKFGEI
1tyyA           --NKVWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
1vk4A           ----ITFIGHVSKDVNVVDGKRE------------IAYGGGVVXGAITSSLLGVKTKVITKCTREDVSK-
2awdA1          ----VTVTXNPSIDISYLLDHL-KLDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGFH-GAF
1dgmA           --------------------------------------GGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
1td2A           ---------------------------------LAIQSYGHAGNSAAEFPRLGANVWPLNTVQFSNHTQ-
2ajrA1          ------------LDREIFIEDF-QVNRLYRINDLSKTQGGKGINVSIALSKLGVPSVATGFVGGYX-GKI
1kyhA           ----------------------------------------------------------------------
1jxhA           -----------------------------------------------------QRINALTIAGTDPSGGA
1lhpA           ----------------------------------------------------------------------
1c3qA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
2fv7A1          YIENLKQNDISTEFTYQTDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLE
1gqtA           VRQQLATDNIDITPVSVIKGETGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
2afbA1          AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEEKILDGARWFHFSGITPPLGK
1v19A           VEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRITPALSP
1wyeA1          AIEWLRGQGVDVSHMKIDPSATGIFFIQRPLKSESIYYRKGSAGSKLSPEDVDEEYVKVHSSGITLAISS
2abqA1          VRNALEKEEIGLSFI----EVEGDTRINVKIKGKQETELNGTAPLIKKEHVLLEQLTELEKGDVLVLAGS
1bx4A           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWVEKARVCYIALT
1tyyA           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNSFTYLVHPGADTYVSPQDLPPFRQY--EWFYFSSIGLTDR
1vk4A           -FSFLRDNGVEVVF----LKSPRTTSIENRYTRESFLISAADPFTESDLAFIEGEAVHINPLWYGEFPED
2awdA1          IANELKKANIP-QAFTSIKEETRDSIAILHEGNQTEILEAGPTSPEEISNFLENFDQLIKQAEIVTISGS
1dgmA           LKELCDKEGLATRFMVAPGQSTGVCAVLINE-KERTLCTHLGACPEDWTTFASGALIFYATAYTLTATPK
1td2A           ----YGKWTGCVMPPSHLT--EIVQGIAAIDKLHTCDAVLSGYLGSAEQ--GEHILGIVRQVKAANPQAK
2ajrA1          LVEELRKISKLITNFVYVEGETRENIEIIDEKNKTITAINFGPD--VTDXDVNHFLRRYSKVDCVVISGS
1kyhA           ---------------------SGLGKLVIGTSENVIPLIVPEATYWRDGWKKAADAQLEETYRAIAIGPG
1jxhA           GIQ------ADLKTFSALGYGCSVITALVAENTCGVQSVYRIEPDFVAAQLDSVF-SDVRIDTTKIGMLA
1lhpA           ----------------------------------------------------------------------
1c3qA1          -----------------------------TNFTANGLLALGAS--PVMAYAKEEVADMAKIAGALVLNIK


                         +         .         .         .         .         *         .:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
2fv7A1          ITPATSLEALTMARRSGVKTLFNPAPAIDLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLL
1gqtA           SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
2afbA1          ELPLILEDALKVANEKGVTVSCDLEEAQKVXIPFXEYVDVLIANEEDIEKVLGISVNREAYAKIAEEVTR
1v19A           EARAFSLWAMEEAKRRGVRVSLDVNYR-QTLWSPEEARGFLERALPGVDLLFLSEEEAELLFGRVEEALR
1wyeA1          TAKEAVYKAFEIASNRSFDTNIRLKLWSAEEAKRKFHLKFLITDTDDSKIILG------ESDPDKAAKAF
2abqA1          VPQAXPQTIYQIAKERGAFVAVDTSGE-ALHEVLAAKPSFIKPNHHELSELVSKPIASIEDAIPHVQRLI
1bx4A           VSPESVLKVAHHASENNRIFTLNLSAYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKQALPKMN
1tyyA           PAREACLEGARRXREAGGYVLFDVDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLR
1vk4A           LIPVLRRKVXFLSADAQVRVPENEKLVYEXKEKYLKYLDLFKVDSREAETLTG-----TNDLRESCRIIR
2awdA1          LAKGLPSDFYQKAHAQEVKVLLDTSGDSQVLQGPWK-PYLIKPNLEELEGLLGQDFSENPLVQTALTKPX
1dgmA           NAFEVAGYAHGIPNAIFTLNLSAPFCYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVTANKEHAVERLL
1td2A           YFCDP------VMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELI
2ajrA1          IPPGVNEGICRLARERGVFVFVEQTPRLERIYEGPEFPNVVKPDRGNHASFLGVDLKTFDDYVKLAEKLA
1kyhA           LPTESVQQAVDHVLTADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRXTGVPVNEQKKRAEYAKEWA
1jxhA           ETDIVEAVAERLQRHHVRNVVLDTSAIETLRVRLLPQVSLITPNLPEAAALLDAPHARTEQEMLAQGRAL
1lhpA           ------------DQRNGEGAMYVPDDLLPVYEKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLH
1c3qA1          ESVEAMIIAGKSANEHGVPVILDPVGATESARDIIREVAAIRGNAAEIAHTVGVTDWLGGDIIRLAQQAA


                         .         .         .         +         .         .         .:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
2fv7A1          KRGCQVVIITLGAEGCVVLSQEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYPNLSLEDMLNRSNFI
1gqtA           EKGIRTVLITLGSRGVWASVNGE-GQRVPGFRVQAVDTIAAGDTFNGALITALLEEKP-LPEAIRFAHAA
2afbA1          KYNFKTVGITLRESISAXVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLXGFD-SQKKAEFAAAA
1v19A           ALSAPEVVLKRGAKGAWAFVDGRRVE-GSAFAVEAVDPVGAGDAFAAGYLAGAVWGLP-VEERLRLANLL
1wyeA1          SDYAEIIVMKLGPKGAIV-YYDGKKYYSSGYQVPVEDVTGAGDALGGTFLSLYYKGFE-MEKALDYAIVA
2abqA1          GEGIESILVSFAGDGALFASAEG-XFHVNVPSGEVRNSVGAGDSVVAGFLAALQEGKS-LEDAVPFAVAA
1bx4A           SKRQRIVIFTQGRDDTIMATESEVTAFLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKP-LTECIRAGHYA
1tyyA           DLGCDTTIISLGADGALLITAEG-EFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANC-WDHALLAEAIS
1vk4A           SFGAK-IILATHASGVIVFDGNFYE--ASFRSWSLEGRTGRGDTCTAAFLVGFVFKKXSIEKATKFAAAV
2awdA1          FAGIEWIVISLGKDGAIAKHHDQF-YRVKIPTIQAKNPVGSGDATIAGLAYGLAKD-APAAELLKWGXAA
1dgmA           TAGQNLVVMTRGHNPAAEQTADGTVVVVPVAAEKIVDTNGAGDAFVGGFLYALSQGKT-VKQCIMCGNAC
1td2A           AQGPQIVLVKHLARAGYSRDRFEMLLVRPLVDFGMRQPVGVGDVTSGLLLVKLLQGAT-LQEALEHVTAA
2ajrA1          EKSQV-SVVSYEVKNDIVATREGVWLIRSKEEIDTSHLLGAGDAYVAGXVYYFIKHGANFLEXAKFGFAS
1kyhA           AQLQTVIVLKGN--QTVIAFPDGD-CWLNPTGNGALAKGGTGDTLTGXILGXLEDPKHAVLNAVYLHGAC
1jxhA           --------LAMGCEAVLMKGDLFTREGEQRFRVNTKNTHGTGCTLSAALAALRPRHRS-WGETVNEAKAW
1lhpA           SMGPDTVVITLSPRGSDYLMALGSQRTRGSVVTQRIVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSA
1c3qA1          QKLNTVIAIT-GEVDVIAD--TSHVYTLHNGHKLLTKVTGAGCLLTSVVGAFCAVEEN-PLFAAIAAISS


                         .         *         .         .         .         .         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSK
2fv7A1          AAVSVQAAGTQSSYPYKKDLPLTL---
1gqtA           AAIAVTRKGAQPSVPWREEIDAFLDRQ
2afbA1          SCLKHTIPGDFVVLS-IEEIEKLAS--
1v19A           GASVAASRGDHEGAPYREDLEVLL---
1wyeA1          STLNVMIRGDQENLPTTKDIETFLRE-
2abqA1          GSATAFSDGF-----------------
1bx4A           ASIIIRRTGCFPEKP------------
1tyyA           NAXAVTAKGAXTALPFPDQLNTFLS--
1vk4A           TSVKXRHPGP----LRREDLE------
2awdA1          GXANAQERXT--GHVDVENVKKHL---
1dgmA           AQDVIQHVGFSLSFT------------
1td2A           VYEIMVTTKQEYELQVVAAQDRIAKP-
2ajrA1          ALAATRRKE--KYXPDLEAIKKEYD--
1kyhA           AELWTDEHSAHTLLA------------
1jxhA           LSAALAQADTLE---------------
1lhpA           MHHVLQR--------------------
1c3qA1          YGVAAQLAAQQTADK------------