[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99260.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ethA1.bssp"
#ERROR : Can't open dsspfile "1s3jA.bssp"
#ERROR : Can't open dsspfile "2a61A1.bssp"
#ERROR : Can't open dsspfile "2fbiA1.bssp"
#ERROR : Can't open dsspfile "2bv6A1.bssp"
#ERROR : Can't open dsspfile "2fbhA1.bssp"
#ERROR : Can't open dsspfile "1z91A1.bssp"
#ERROR : Can't open dsspfile "1p4xA1.bssp"
#ERROR : Can't open dsspfile "3broA1.bssp"
#ERROR : Can't open dsspfile "1lnwA.bssp"
#ERROR : Can't open dsspfile "3bz6A2.bssp"
#ERROR : Can't open dsspfile "1lj9A.bssp"
#ERROR : Can't open dsspfile "1jgsA.bssp"
#ERROR : Can't open dsspfile "2fbkA1.bssp"
#ERROR : Can't open dsspfile "1sfxA.bssp"
#ERROR : Can't open dsspfile "2hr3A1.bssp"
#ERROR : Can't open dsspfile "1tbxA.bssp"
#ERROR : Can't open dsspfile "1hsjA1.bssp"
#ERROR : Can't open dsspfile "2obpA1.bssp"
#ERROR : Can't open dsspfile "2fxaA1.bssp"
#ERROR : Can't open dsspfile "1p4xA2.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1okrA.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"

## Summary of PDB Search
:146
    2e-15  22%  2ethA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR, PUTATIVE, MAR FAMILY
    5e-10  15%  1s3jA  [a.4.5.28] YUSO PROTEIN
    6e-10  17%  2a61A1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR TM0710 A:5 -- 143
    4e-09  13%  2fbiA1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:5 -- 140
    6e-09  14%  2bv6A1 [a.4.5.28] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA A:5 --
    9e-09  14%  2fbhA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR PA3341 A:8 -- 144
    2e-08  19%  1z91A1 [a.4.5.28] ORGANIC HYDROPEROXIDE RESISTANCE TRANSCRIPTIONAL
    5e-08  14%  1p4xA1 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    7e-08  18%  3broA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR A:3 -- 137
    2e-07  15%  1lnwA  [a.4.5.28] MULTIDRUG RESISTANCE OPERON REPRESSOR
    2e-07  12%  3bz6A2 [a.4.5.75] UPF0502 PROTEIN PSPTO_2686 A:97 -- 180
    3e-07  15%  1lj9A  [a.4.5.28] TRANSCRIPTIONAL REGULATOR SLYA
    3e-07  18%  1jgsA  [a.4.5.28] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
    3e-07  20%  2fbkA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR, MARR FAMILY A:8 -- 179
    5e-06   9%  1sfxA  [a.4.5.50] CONSERVED HYPOTHETICAL PROTEIN AF2008
    2e-05  15%  2hr3A1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 146
    4e-05  14%  1tbxA  [a.4.5.48] HYPOTHETICAL 11.0 KDA PROTEIN
    7e-05  12%  1hsjA1 [a.4.5.28] FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS A:373
    8e-05  14%  2obpA1 [a.4.5.71] PUTATIVE DNA-BINDING PROTEIN A:12 -- 92
    2e-04  19%  2fxaA1 [a.4.5.28] PROTEASE PRODUCTION REGULATORY PROTEIN HPR A:6
    3e-04   9%  1p4xA2 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    3e-04  14%  1xd7A  [a.4.5.55] YWNA
    4e-04  18%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    5e-04  16%  1okrA  [a.4.5.39] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    5e-04  18%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
:146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
2ethA1          ---------DALEKTLFSLVXRFSSYLPSNEISDXKTTELYAFLYVALFGPKKXKEIAEFLSTTKSNVTN
1s3jA           ---------------------------------GVTPAQLFVLASLKKHGSLKVSEIAERXEVKPSAVTL
2a61A1          -----QPFERILREICFMVKVEGRKVLRDF---GITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTG
2fbiA1          ----------TLLQAREAAMSFFRPSLNQH---GLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTG
2bv6A1          ---------------------------------NLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSP
2fbhA1          ----------LLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHR--DSPTQRELAQSVGVEGPTLAR
1z91A1          ----------LLYASSREMTKQYKPLLDKL---NITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTP
1p4xA1          MKYNNHDKIRDFIIIEAYMFRFKKKVKPEV---DMTIKEFILLTYLFHQQENTLPFIVSDLCYKQSDLVQ
3broA1          ---------------------------------DLTGTQXTIIDYLSRNKNKEVLQLESEFSIKSSTATV
1lnwA           --PVNPDLXPALXAVFQHVRTRIQSELDCQRL-DLTPPDVHVLKLIDEQRGLNLQDLGRQXCRDKALITR
3bz6A2          ---------------------------------ELVPAQVILTGLLLLRGPQTVSELLTRSFEDSEQVVH
1lj9A           ----------EIGMIARALDSISNIEFKEL---SLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAAR
1jgsA           LFNEIIPLGRLIHMVNQKKDRLLNEYLSPL---DITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTR
2fbkA1          ----------------------------------------------------RPTELSALAAISGPSTSN
1sfxA           ---------------------------------SFKPSDVRIYSLLLERGGXRVSEIARELDLSARFVRD
2hr3A1          --NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL--GGDVTPSELAAAERXRSSNLAA
1tbxA           --------------------------------TPFFYPEAIVLAYLYIATYDLYKKVNAEFPXSTATFYD
1hsjA1          ----------DLVNATFQVKKFFRDTKKKF---NLNYEEIYILNHILRSESNSSKEIAKCSEFKPYYLTK
2obpA1          -----------------------------------VLLVLREAGIENGATPWSLPKIAKRAQLPXSVLRR
2fxaA1          ----------LSKALWKSIEKDWQQWLKPY---DLNINEHHILWIAYQLNGASISEIAKFGVXHVSTAFN
1p4xA2          ---------------------------------TLSFVEFTILAIITSQNKNIVLLLIETIHHKYPQTVR
1xd7A           -------------------------------------VAIHILSLISMDEKTSSEIIADSVNTNPVVVRR
1qbjA           -----------------------------SIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINR
1okrA           ---------------------------------EISSAEWEVMNIIYASANNIIEEIQMQKDWSPKTIRT
1wi9A           --------------------------------SSGFLTEF--INYIKKSKVVLLEDLAFQMGLRTQDAIN


                         .         .         *         .         .         .         .:140
query           TIDRLCRKGYAEXXXXXXXXXXXXXXLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLED
2ethA1          VVDSLEKRGLVVREXDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRXVE
1s3jA           XADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIXARYLSFLTEEEXLQAAHITAKLAQ
2a61A1          LVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKG
2fbiA1          VLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELK-
2bv6A1          LLKRXEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVAS--ASSLSQDEVKELNRLLGKV--
2fbhA1          LLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILA
1z91A1          MLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILG--LSKQSGEDLKQLKSALYTLLE
1p4xA1          HIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSE--------------
3broA1          LLQRXEIKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYXDSDQSQXTSGLNKEEVVFLEK-------
1lnwA           KIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIXSRVHDELFAPLTPVEQATLVHLL-----
3bz6A2          QLERLIARGLATLVPRQSGQREDRYXHLIGDP--------------------------------------
1lj9A           AIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRK
1jgsA           MLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVG---------------------------
2fbkA1          RIVRLLEKGLIE-------RREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRM--
1sfxA           RLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEI-------------------------
2hr3A1          LLRELERGGL------IVRHARTRVSLSSEGRRNLGNRAKREEWLVRAXHACLDESERALLAAAGPLLTR
1tbxA           AKKFLIQEGFVK---ERQERGEKRLYLTEKGKLFATAIETYKQIK-------------------------
1hsjA1          ALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIK-----------------------
2obpA1          VLTQLQAAGLAD--VSVEADGRGHASLTQEGAALAA----------------------------------
2fxaA1          FSKKLEERGY------------------------------------------------------------
1p4xA2          ALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLLAQVN---------------------------
1xd7A           MISLLKKADILTSRAGVPGASLKKDPADISL---LEVYRAVQKNPKCPVGKKIQNALDETFESVQRAMEN
1qbjA           VLYSLAKKGK------------------------------------------------------------
1okrA           LITRLYKKGFID--RKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEE
1wi9A           RIQDLLTEGTLT---GVIDDRGKFIYITPSGP--------------------------------------


                         +         .         .         .         .         *         .:210
query           FLKEHS
2ethA1          ALS---
1s3jA           AAET--
2a61A1          VMERN-
2fbiA1          ------
2bv6A1          ------
2fbhA1          NLEN--
1z91A1          TL----
1p4xA1          ------
3broA1          ------
1lnwA           ------
3bz6A2          ------
1lj9A           NV----
1jgsA           ------
2fbkA1          ------
1sfxA           ------
2hr3A1          LAQF--
1tbxA           ------
1hsjA1          ------
2obpA1          ------
2fxaA1          ------
1p4xA2          ------
1xd7A           ELASKS
1qbjA           ------
1okrA           L-----
1wi9A           ------