[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99261.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eblA1.bssp"
#ERROR : Can't open dsspfile "1tedA.bssp"
#ERROR : Can't open dsspfile "1u0mA2.bssp"
#ERROR : Can't open dsspfile "1na6A2.bssp"
#ERROR : Can't open dsspfile "1bi5A1.bssp"
#ERROR : Can't open dsspfile "1tvzA1.bssp"
#ERROR : Can't open dsspfile "1bi5A2.bssp"
#ERROR : Can't open dsspfile "1tvzA2.bssp"
#ERROR : Can't open dsspfile "1eblA2.bssp"
#ERROR : Can't open dsspfile "1dluA1.bssp"
#ERROR : Can't open dsspfile "1u0mA1.bssp"
#ERROR : Can't open dsspfile "1hnkA2.bssp"
#ERROR : Can't open dsspfile "1afwA2.bssp"
#ERROR : Can't open dsspfile "1q5fA.bssp"
#ERROR : Can't open dsspfile "1b3nA1.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"

## Summary of PDB Search
:326
    3e-49  36%  1eblA1 [c.95.1.2] BETA-KETOACYL-ACP SYNTHASE III A:1 -- 174
    1e-36  16%  1tedA  [c.95.1.2] PKS18
    3e-28  21%  1u0mA2 [c.95.1.2] PUTATIVE POLYKETIDE SYNTHASE A:202 -- 349
    1e-25  12%  1na6A2 [c.52.1.22] RESTRICTION ENDONUCLEASE ECORII A:179 -- 398
    1e-25  19%  1bi5A1 [c.95.1.2] CHALCONE SYNTHASE A:1 -- 235
    4e-25  18%  1tvzA1 [c.95.1.2] 3-HYDROXY-3-METHYLGLUTARYL-COA SYNTHASE A:2 --
    1e-21  26%  1bi5A2 [c.95.1.2] CHALCONE SYNTHASE A:236 -- 389
    7e-21  20%  1tvzA2 [c.95.1.2] 3-HYDROXY-3-METHYLGLUTARYL-COA SYNTHASE A:168 --
    6e-20  32%  1eblA2 [c.95.1.2] BETA-KETOACYL-ACP SYNTHASE III A:175 -- 317
    1e-18  11%  1dluA1 [c.95.1.1] BIOSYNTHETIC THIOLASE A:4 -- 268
    1e-17  19%  1u0mA1 [c.95.1.2] PUTATIVE POLYKETIDE SYNTHASE A:2 -- 201
    7e-17  30%  1hnkA2 [c.95.1.2] BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III
    9e-15  16%  1afwA2 [c.95.1.1] 3-KETOACETYL-COA THIOLASE A:294 -- 417
    9e-14  13%  1q5fA  [d.24.1.1] PILS
    6e-07  16%  1b3nA1 [c.95.1.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    8e-04   9%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    8e-04  16%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
1eblA1          -----IIGTGSYLPEQVRTNADLEKXVDTSDEWIVTRTGIRERHIAANETVSTXGFEAATRAIEXAGIEK
1tedA           -----IEGLATGTPRRVVNQSDAADRVAELGQRVYQKSRITTRRMAVYEHAVPLAVDVSKRALAGLPYRA
1u0mA2          ----------------------------------------------------------------------
1na6A2          LRFPSGSEIIQYAASHYDPDEQLLDRRRVEYDIFLEELHVLDIIRKGVDEFIALANSVSNRRKSRAGKSL
1bi5A1          -----ILAIGTANPANCVEQSTYPDFYKEKFQRMCDKSMIKRRYMYLVVEVPRLGKEAAVKAIKEWGQPK
1tvzA1          -----IDKINFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMAVSPNQDIVSMGANAAKDIITDE--DK
1bi5A2          ----------------------------------------------------------------------
1tvzA2          ----------------------------------------------------------------------
1eblA2          ----------------------------------------------------------------------
1dluA1          ------------------------------------RTAVGSFNGAFNTPAHELGATVISAVLERAGVAA
1u0mA1          -----------SVPEHVITMEETLELQLPLALRLIENTGVRTRHIVQPIEDTSRVPAVIQRALDDAELLA
1hnkA2          ----------------------------------------------------------------------
1afwA2          ----------------------------------------------------------------------
1q5fA           ----------------------------------------------------------------------
1b3nA1          ------------------------------------------------------------------TSLM
1pmmA           ----------------------------------------------------------------------
3bc8A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
1eblA1          DQIGLIVVATTSATHAFPSAACQIQSXLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
1tedA           AEIGLLVLATSTGFI-APGVDVAIVKELGLSPSIVVVNFMGCAAAMNALGTATNYVRAHPAMKALVVCIE
1u0mA2          ----------------------------------------------------------------------
1na6A2          EEHGLRHFATQAPDFLFPSAGAYHPLRMLAVKTTCKDRWRQILNHLFTLQEGVSYREMRESGVRLVVPSS
1bi5A1          SKITHLIVCTTSGVDM-PGADYQLTKLLGLRPYVKRYMMYQQFAGGTVLRLAKDLAENNKGARVLVVCSE
1tvzA1          KKIGMVIVATESAVDAAKAAAVQIHNLLGIQPFACFEMKEAXYAATPAIQLAKDYLATRPNEKVLVIATD
1bi5A2          ----------------------------------------------------------------------
1tvzA2          ----------------------------------------------------------------------
1eblA2          ----------------------------------------------------------------------
1dluA1          GEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEAAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGME
1u0mA1          TDIDVIIYVSCTGFMMPSLTAWLINEMGFDSTRQIPIAQLGCAAGGAAINRAHDFCTAYPEANALIVACE
1hnkA2          ----------------------------------------------------------------------
1afwA2          ----------------------------------------------------------------------
1q5fA           ---------------WGKKDAGTELTNYQATNTIGMMKGVDGYAFTSGAKMTDTLIQAGAAKGMTVSGDP
1b3nA1          NGGPRKISPFFVPSTI-VNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAE
1pmmA           ----------------------------------------------------------------------
3bc8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRK
1eblA1          VLARTCDPTDRGTIIIFGDGAGAAVLAASEE---------------------------------------
1tedA           LCSVNAVFADINDVVIHSLFGDGCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTEDGIVLG----VNH
1u0mA2          ----------------------------------------------------------------------
1na6A2          LHKKYPEAVRAELMTFIAELT-------------------------------------------------
1bi5A1          VTAVTFHLDSLVGQALFGDGAAALIVG-------------------------------------------
1tvzA1          TARYGLNSGGEP---TQGAGAVAMVIA-------------------------------------------
1bi5A2          ----------------------------------------------------------------------
1tvzA2          ----------------------------------------------------------------------
1eblA2          -------------THLHADGSYGELLTLPNA-----DRVNPENSIHLTXA--------------------
1dluA1          SMSMAPHCAHLRGGVKMGDFKMIDTMI----KDGLTDAFYGYHMGTTAENVAKQLSREQDAFAVASQNKA
1u0mA1          FCSLCYQPTDLGVGSLFGDGIAAAVVR-------------------------------------------
1hnkA2          ----------------------------------------------------------------------
1afwA2          ----------------------------------------------------------------------
1q5fA           ASGSATLWNSWGGQIVVAPDTAG-----------------------------------------------
1b3nA1          KASTPLPWDKERDGFVLGDGAGMLVLEEYEH---------------------------------------
1pmmA           --------------------------------------------------------DGEDPGYTLYDLSE
3bc8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
1eblA1          ----------------------------------------------------------------------
1tedA           NGITCELSENLPGYIFSGVAPVVTEMLWDNGLQISDIDLWAIHPGGPKIIEQSVRSLGISAELAAQSLAR
1u0mA2          ---FHFLLDKRVPATMEPLAPALKELAGEHGWDASDLDFYIVHAGGPRILDDLSTFLEVDPHAFRATLTE
1na6A2          ----------------------------------------------------------------------
1bi5A1          ----------------------------------------------------------------------
1tvzA1          ----------------------------------------------------------------------
1bi5A2          ---TFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
1tvzA2          --YPLVDGALSKDAYIRSFQQSWNEYAKRQGKSLADFASLCFHVPFTKMGKKALESIIDNADETTDYNRY
1eblA2          -------GNEVFKVAVTELAHIVDETLAANNNDRSQLDWLVPHQANLRIISATAKKLGXSXDNVVVTLDR
1dluA1          EAAFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTV--------------------
1u0mA1          ----------------------------------------------------------------------
1hnkA2          -------STHLHADGSTELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR
1afwA2          ---FQTVGVPPEIMGVGPAY-AIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGA
1q5fA           ----------------------------------------------------------------------
1b3nA1          ----------------------------------------------------------------------
1pmmA           RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLL------EDYKASLKYLSDH----------
3bc8A1          --------FRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFI------KRLDKCLNIVRKEQTR-------


                         .         *         .         .         .         .         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY
1eblA1          ----------------------------------------------
1tedA           FGNMLSVSLIFVLETMVQQAESAKASTGVAFAFGPGVTVEGMLFD-
1u0mA2          YGNIASAVVLDALRRLFDEGGVEEGARGLLAGFGPGITAEMSLGCW
1na6A2          ----------------------------------------------
1bi5A1          ----------------------------------------------
1tvzA1          ----------------------------------------------
1bi5A2          YGNMSSACVLFILDEMRKKSTQNGLKTTVLFGFGPGLTIETVVLR-
1tvzA2          VGNIYTGSLYLSLISLLENRDLQAGETIGLFSYGSGSVVEFYSAT-
1eblA2          HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
1dluA1          ----------------------------------------------
1u0mA1          ----------------------------------------------
1hnkA2          HGNTSAASVPCALDEAVRDGRIKPGQLV---LLEAFFTWGSALVRF
1afwA2          LGHPLGCTGARQVATILRELKKDQI-GVVSMCIGTGMGAAAIFIK-
1q5fA           ----------------------------------------------
1b3nA1          ----------------------------------------------
1pmmA           ----------------------------------------------
3bc8A1          ----------------------------------------------