[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99301.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ij5A.bssp"

## Summary of PDB Search
:448
    1e-04  27%  1ij5A  [a.39.1.9] PLASMODIAL SPECIFIC LAV1-2 PROTEIN[MASQUE :
:448

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSERKLNKNIID
1ij5A           ----------------------------------------------------------LSERQLFLSSVS


                         .         .         *         .         .         .         .:140
query           GLGISIPELYDARLKLEATGLIKTFEGEDKLGKYHIYELQKPLNEVKFFTDDLLSTALLEMVGNEKFKKL
1ij5A           GSGFSFQDLKQV---LAKYADTIP-EGP----------LKKLFVMVENDTKGRMSYITLVAVANDLAALV


                         +         .         .         .         .         *         .:210
query           SLWNKFDNNYHDKKEVTKQFFDVFNLNKDNIVLQAQLNNSKISNDESLINRQKVSLDMTVFSDFIKNSYV
1ij5A           ADFRKIDTNTLSRKEF-REHFVRLGFDKDALFRYADEDESDVGFSEYVLGLCLLVLRLYAFADFDKSGQL


                         .         .         .         +         .         .         .:280
query           SSDDVMNHLDIIKSVKLVYGIDEFQLVKLLEKAINVTNNKIDYNEFxxxxxxxxxxxxxxxxxxxxxxxx
1ij5A           SKEEVQKVLE-------DAHIPESARKKFEHSVVDVDDSKLSYQEF------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ij5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ij5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ij5A           ----------------------------