[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99303.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1evkA2.bssp"
#ERROR : Can't open dsspfile "1asyA2.bssp"
#ERROR : Can't open dsspfile "1atiA2.bssp"
#ERROR : Can't open dsspfile "1serA2.bssp"
#ERROR : Can't open dsspfile "1adjA2.bssp"
#ERROR : Can't open dsspfile "1nyqA3.bssp"
#ERROR : Can't open dsspfile "1wu7A2.bssp"
#ERROR : Can't open dsspfile "1h4qA2.bssp"
#ERROR : Can't open dsspfile "1r8gA.bssp"
#ERROR : Can't open dsspfile "1usyA.bssp"
#ERROR : Can't open dsspfile "1v4pA.bssp"
#ERROR : Can't open dsspfile "1o6dA.bssp"
#ERROR : Can't open dsspfile "1n4kA1.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "1z7mA1.bssp"
#ERROR : Can't open dsspfile "1evkA1.bssp"
#ERROR : Can't open dsspfile "1gc5A.bssp"
#ERROR : Can't open dsspfile "1c0aA3.bssp"
#ERROR : Can't open dsspfile "1h4qA1.bssp"
#ERROR : Can't open dsspfile "1g5hA1.bssp"
#ERROR : Can't open dsspfile "1v95A.bssp"
#ERROR : Can't open dsspfile "1wu7A1.bssp"
#ERROR : Can't open dsspfile "1adjA1.bssp"
#ERROR : Can't open dsspfile "1httA1.bssp"
#ERROR : Can't open dsspfile "1nyqA2.bssp"
#ERROR : Can't open dsspfile "1atiA1.bssp"
#ERROR : Can't open dsspfile "1qe0A1.bssp"
#ERROR : Can't open dsspfile "1qf6A2.bssp"
#ERROR : Can't open dsspfile "1rwsA.bssp"
#ERROR : Can't open dsspfile "1k8kD1.bssp"
#ERROR : Can't open dsspfile "1zud21.bssp"
#ERROR : Can't open dsspfile "1vjkA.bssp"
#ERROR : Can't open dsspfile "1gw6A1.bssp"
#ERROR : Can't open dsspfile "1wxqA2.bssp"
#ERROR : Can't open dsspfile "1tygB.bssp"
#ERROR : Can't open dsspfile "1e1cB2.bssp"
#ERROR : Can't open dsspfile "2hj1A1.bssp"
#ERROR : Can't open dsspfile "1fm0D.bssp"
#ERROR : Can't open dsspfile "1g6sA.bssp"

## Summary of PDB Search
:649
    e-100  38%  1evkA2 [d.104.1.1] THREONYL-TRNA SYNTHETASE A:242 -- 532
    8e-45  10%  1asyA2 [d.104.1.1] ASPARTYL-TRNA SYNTHETASE A:205 -- 557
    1e-44  16%  1atiA2 [d.104.1.1] GLYCYL-TRNA SYNTHETASE A:1 -- 394
    9e-42  18%  1serA2 [d.104.1.1] PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))
    2e-40  16%  1adjA2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:2 -- 325
    1e-38  47%  1nyqA3 [d.67.1.1] THREONYL-TRNA SYNTHETASE 1 A:63 -- 241
    9e-37  15%  1wu7A2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:3 -- 329
    9e-35  17%  1h4qA2 [d.104.1.1] PROLYL-TRNA SYNTHETASE A:5 -- 276
    4e-32  11%  1r8gA  [d.128.1.3] HYPOTHETICAL PROTEIN YBDK
    3e-29  14%  1usyA  [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-28  19%  1v4pA  [d.67.1.2] ALANYL-TRNA SYNTHETASE
    1e-26  14%  1o6dA  [c.116.1.3] HYPOTHETICAL UPF0247 PROTEIN TM0844
    2e-26   9%  1n4kA1 [a.118.22.1] INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR TYPE 1
    2e-26  16%  1b70A  [d.104.1.1] PHENYLALANYL-TRNA SYNTHETASE
    6e-26  12%  1z7mA1 [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-25  44%  1evkA1 [c.51.1.1] THREONYL-TRNA SYNTHETASE A:533 -- 642
    6e-25   8%  1gc5A  [c.72.1.3] ADP-DEPENDENT GLUCOKINASE
    8e-25  15%  1c0aA3 [d.104.1.1] ASPARTYL TRNA SYNTHETASE A:107 -- 287 A:421 --
    1e-23  32%  1h4qA1 [c.51.1.1] PROLYL-TRNA SYNTHETASE A:277 -- 403
    2e-23  13%  1g5hA1 [c.51.1.1] MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT
    4e-22  21%  1v95A  [c.51.1.1] NUCLEAR RECEPTOR COACTIVATOR 5
    4e-21  20%  1wu7A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:330 -- 426
    1e-20  16%  1adjA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 421
    5e-20  16%  1httA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 424
    5e-20  61%  1nyqA2 [d.15.10.1] THREONYL-TRNA SYNTHETASE 1 A:4 -- 62
    6e-20  22%  1atiA1 [c.51.1.1] GLYCYL-TRNA SYNTHETASE A:395 -- 505
    4e-18  23%  1qe0A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 420
    4e-17  38%  1qf6A2 [d.15.10.1] THREONYL-TRNA SYNTHETASE A:2 -- 62
    2e-12  19%  1rwsA  [d.15.3.2] HYPOTHETICAL PROTEIN PF1061
    2e-11   9%  1k8kD1 [d.198.2.1] ARP2/3 COMPLEX 34 KDA SUBUNIT D:1 -- 120
    3e-10  16%  1zud21 [d.15.3.2] THIS PROTEIN 2:2 -- 66
    4e-09  15%  1vjkA  [d.15.3.1] MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
    7e-09  13%  1gw6A1 [a.118.1.7] LEUKOTRIENE A-4 HYDROLASE A:461 -- 610
    1e-08  16%  1wxqA2 [d.15.10.2] GTP-BINDING PROTEIN A:320 -- 395
    4e-08  16%  1tygB  [d.15.3.2] YJBS
    4e-06   7%  1e1cB2 [c.23.6.1] METHYLMALONYL-COA MUTASE BETA CHAIN B:476 -- 638
    2e-05  21%  2hj1A1 [d.15.3.4] HYPOTHETICAL PROTEIN A:11 -- 87
    3e-05  12%  1fm0D  [d.15.3.1] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 1
    2e-04  18%  1g6sA  [d.68.2.2] EPSP SYNTHASE
:649

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
1evkA2          ----------------------------------------------------------------------
1asyA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1nyqA3          --------------------------------------------------------------TPGSEEAL
1wu7A2          ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1v4pA           -------------------------------------------------------------------YSI
1o6dA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ---INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIV--------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIIT-------
1rwsA           ---KVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIA--KVNGKVVLEDDEVKDGDFVEVIP-------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----QIL-FNDQAMQCAAGQTVHELLEQLDQRQAGAALAQQIVPREQWAQHIVQDGDQILLFQ-------
1vjkA           -DEEEIELPEGAIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGVFP-------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          -----YPVHDEQFGNVLKGSTPRDLAFKVHTDLGKGFLYAINARTRVGEDYELQFNDIVKIVS-------
1tygB           -----MLQLNGKDVKWKKDTGTIQ-DLLASYQLENKIVIVERNKEIIYHEVELCDRDVIEIVH-------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          QINIEIAYAFPKSFQVDEGITVQTAITQSGIEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIY--------
1fm0D           --ATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAA--VNQTLVSFDHPLTDGDEVAFFP-------
1g6sA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVLWRTAAQVLANALHELYPNMKFGMGDVTEHGFYFDTDNSESQVAETDFEKISQKMSEIIKANLPIERV
1evkA2          ----------------------------------------------------------------------
1asyA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1nyqA3          EVLRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQN-ISSDDFEQIEKTMKQIVNENMKIERK
1wu7A2          ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1v4pA           EVRTHSALHVVKGAVVKVLSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIY
1o6dA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          -----------NRIIEETLALKFENAAANKPEAVEVTFADFDG-----VLYHISNPNGDKTKVMVSISLK
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EFSEEEALNLVSGDEYQEELVRDVANKNNGRVVAYKQGDFIDITDGVVLSSTGEVKIFKLLSVAGAYWKG
1evkA2          ----------------------------------------------------------------------
1asyA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1nyqA3          VVSRDEAKELFSNDEYKLELIDAI--PEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRG
1wu7A2          ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1v4pA           ELPREEAEKMFGEDMYDLFPVPEDVRI---LKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKG
1o6dA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          FYKELQAHGADELKRVYGSYLVNPESGYN-----VSLLYDLENLPASKDSIVHQAGMLK-----------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ASSNPMLQRIYGTAFYKQKDLDAELQRQKEARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVI
1evkA2          ---------------------------------RDHRKIGKQLDLYHMQE-EAPGMVFWHNDGWTIFREL
1asyA2          --------------------LEDASRSEAEAEAAGLPVVNLDTRLDYRVID---LRTVTNQAIFRIQAGV
1atiA2          --------------------------------------------RGFIFQGGLQGVYDYGPLGVELKNNL
1serA2          ---NREIKRVGGPPEF-------------SFPPLDHVALMEKNGWWEISQVSGSRSYALKGDLALYELAL
1adjA2          -------------------------------------------------ARAVRGTKDLFGKELRMHQRI
1nyqA3          DSNNKMLQRIYGTAFFDKKELKAHLQMLEERKER------------------------------------
1wu7A2          ------------------------------------------------QIEKIRGFRDFYPEDXDVEKFI
1h4qA2          -----------GLTPQSQDFSEWYLEVIQKAELADYGPV--------------RGTIVVRPYGYAIWENI
1r8gA           ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------SFYSKA
1v4pA           ------LLEIHFELL-------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1n4kA1          -------------------------------------------------PA-EVRDLDFANDASKVLGSI
1b70A           ------------------------------------------------------GASLFSGGLH-PITLM
1z7mA1          ---------------------------------------------------LPEESAEMTLNQVKSLRQI
1evkA1          ----------------------------------------------------------------------
1gc5A           ----GVYRIPTIVHVPQNPKLQAELFVDGPIYVPVFEG------NKLKLVHPKDAIAEEEELIHYIYEFP
1c0aA3          ----------------------------------------------------------EMAQRLKTRAKI
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHK
1evkA2          EVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSS--ENREYCIKPMNCPGHVQIFNQGL
1asyA2          CELFREYLATKKFTEVHTPKL--------LGAPSEGGSSVFEVTYFKG--KAYLAQSPQF-------NKQ
1atiA2          KQAWWRRNVYDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPGRGLLAYLRPETAQGIFVNFKNVL
1serA2          LRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAE----TDLYLTGTAEVVLNALHSGEI
1adjA2          VATARKVLEAAGALELVTPIFTQVFEKGVGAATDIVRKEMFTFQDR-GGRSLTLRPEGTAAMVRAYLEHG
1nyqA3          ----------------------------------------------------------------------
1wu7A2          FKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDK--GGREVTLIPEATPSTVRXV--TS
1h4qA2          QQVLDRMFKETGHQNAYFPLFIPMSFLRFSPELAVVTHAGGEE----LEEPLAVRPTSETVIGYMWSKWI
1r8gA           ----------------------------------------------------------------------
1usyA           TKK--------GFSPFFVPALEKAEEPAGNFFLDR------------KGNLFSIREDFTK---TVLNHRK
1v4pA           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1n4kA1          AGKLEKGTITQNERRSVTKLLEDLVYFVTGGNSGQDVLEVVFSKPNRERQKL-MREQNILKQIFKLLQAP
1b70A           ERELVEIFRALGYQAVEGPEVESEALNIPEHHPARDMWDTFWLTGEGFGEEVEGRLLLRT-HTSPMQVRY
1z7mA1          EGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEG--QSITLRYDFTLPLVRLYS
1evkA1          ----------------------------------------------------------------------
1gc5A           RGF--------QVFDVQAPRENRFIANADDYNARVYMRREFREGF----EEITRNVELAI----------
1c0aA3          TSLVRRFMDDHGFLDIETPML--------TKATPEGARDYLVPSRVHKG-----KFYALPQSPQL--FKQ
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ---------------LTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLPLPLGHIKEVYNFNA
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD
1evkA2          KSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEK
1asyA2          QLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEI
1atiA2          DATSRLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSR
1serA2          LPYEALPLRYAGYAPAFRSEAGSFVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELPY
1adjA2          MKVWPQPVRLWMAGPMFRAERPQKG----RYRQFHQVNYEALGSENPILDAE--AVVLLYECLKELGLRR
1nyqA3          ----------------------------------------------------------------------
1wu7A2          RKDLQRPLRWYSFPKVWRYEEP----QAGRYREHYQFNADIFGSDSPEADAE--VIALASSILDRLGLQI
1h4qA2          RSWRDLPQLLNQWGNVVRWEMR--TRPFLRTSEFLWQEGHTHATREEAEEEVRRMLSIYARLAREYAAIP
1r8gA           -------------------VSEPFTLGIELXQVVNPPGYDLSQDSSXLIDAVKNKI---TAGEVKHDITE
1usyA           RYSPDSQIKVWYADFVYRYSG-------SDLVAEY-QLGLEKVPRNSLDDSLE-VLEIIVESASEFFEGP
1v4pA           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1n4kA1          FTHAPFRHICRLCYRVLRHSQQDYR----KNQEYIAKQFGFM--QKQIGYDVLAEDTITALLHNN-----
1b70A           MVAHTPPFRIVVPGRVFRFEQTDAT----HEAVFHQLEGLVVGEGIAMAHLKGAIY----ELAQALFGPD
1z7mA1          QIKDSTSARYSYFGKIFRKE-----------KENYQIGIELFGESADKSELE--ILSLALQVIEQLGLNK
1evkA1          ----------------------------------------------------------------------
1gc5A           ISGLQVLKEYYPDGTTYKDVLDRVESHLNINRYNVKSHFEFYTANRRVREALVELLPFTSVGLNEVELAS
1c0aA3          LLMMSGFDRYYQIVKCFRDEDLRAD----RQPEFTQIDVESFMTAPQVREVMEALVRHLWLEVKGVDLGD
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          INNSEIRFRWLRLCIQSKWEDAIPLALTEQGRMKFTRPLFKDLAAFDSHDQAVRTYQEHKASMH------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMGLXXXXXXXXXXXXXPKIDVQTKTALGGEETLS
1evkA2          IVVKLSTRP----EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCG
1asyA2          ELVRKQYPVEEFKLPKDGKMVRLTGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTM
1atiA2          ENLVPYQQPPESSAHYAKDILYRFPHGSLELEGIAQR---------------TDFDLGSHTK-DQEALGI
1serA2          RLVEVATGDMGPGKWRQVDIEVYLPSEGRYR-----------------------------------ETHS
1adjA2          LKVKLSSVGDPEDRARYNAREVLSPHREALSEDILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVE
1nyqA3          ----------------------------------------------------------------------
1wu7A2          YEIRINSR-KIXEEIIGGXTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSXIADLCSGTRGID
1h4qA2          VIEGLTEKEKFAGAVYTTTIEALMKDG------------------------------------KALQAGT
1r8gA           SXLELATDVCRDIN---QAAGQFSAXQKVVLQAATDHHLEICGGGT------HPFQKWNFGYLIQQATVF
1usyA           VIVEIGHTGVYEDL----LKEIPKDLHEKVLNLIDTKNLEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEH
1v4pA           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1b70A           SKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLG
1z7mA1          TVFEIGSAKFFQRLCQLAD---------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1gc5A           IMEIIGDEELAKEVLEGHIFSVIDAMN-------------------------------------------
1c0aA3          FPVMTFAEAERGSDKPDLRDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVA
1h4qA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           -----------------------------------------------------------DIVLTGEPRMK


                         *         .         .         .         .         +         .:560
query           TIQLDFLLPERFDLKYIGADGEEHRPVMVHRGIVSTMERFTAYLTEMYKGAFPTWLAPHQVDIIPVKNDL
1evkA2          TVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAG--------------------
1asyA2          PDPANPKYSNSYDFAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVM-FYL
1atiA2          TARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAF----------------------
1serA2          CSALLDWQARRANLRYRDPEGRVRYAYTLNNTALAT-PRILAMLLENHQLQDGRVRVPGKEVLEPC----
1adjA2          RHLERLSVPYELEPAYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGV---------------
1nyqA3          ----------------------------------------------------------------------
1wu7A2          EXARITGKSASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLXSGESVPAVG-
1h4qA2          SHYLGENFARAFDIKF---QDRDLQVKYVHTTSWGLSWRFIGAIIMTHGD--------------------
1r8gA           GQHVHVGCASGDDAIYLLHGLSRFVPHFIA--LSAASPYXQGTDTRFASSRPNIFSAFPDNGPXPWVSNW
1usyA           LKTMDLPLSVREDLLSASSFLQETVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVA-------------
1v4pA           ----------------------------------------------------------------------
1o6dA           ----------------------------VRIAVIGKLDGFIKEGIKHYEKFLRRFCKPEVLEIKRVHRGS
1n4kA1          ----------------------------------------------------------------------
1b70A           VERLAML----------------RYGIPDIRYFFGGRLKFLEQFKGVL----------------------
1z7mA1          ----------------------------------------------------------------------
1evkA1          ---------------------------------------------------FPTWLAPVQVVIMNI-TDS
1gc5A           ----------------------------------------------------------------------
1c0aA3          NAYDMVINGYEVGGGSVNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTAAACL
1h4qA1          ------------------------------------------------RGVLPPRLAPIQVVIVPIYKDE
1g5hA1          ---------------------------------------------------LHPCLAPIKVALDVGPTVE
1v95A           ---------------------------------------------------SSGSSGPVDCSVIVV-NKQ
1wu7A1          ---------------------------------------------------------KKSVYICRV-GKI
1adjA1          ---------------------------------------------------------GPDLYLIPLTEE-
1httA1          ---------------------------------------------------------VVDIYLVASGAD-
1nyqA2          ----------------------------------------------------------------------
1atiA1          -------------------------------------------------------LAPIKVAVIPLNRPE
1qe0A1          --------------------------------------------------------ENLDLFIVTMGDQ-
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          ------------------------------------WHRDSEVFEQLMD-RSTSVSERPKVFLACLTRRD
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           ERPIGHLVDRLGGAKITYLEQENYPPLRLQGGVDVDGSVSSQFLTALLMTAP---LAPEDTVIRIKGDLV


                         .         .         .         *         .         .         .:630
query           HMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTNTMT
1evkA2          ----------------------------------------------------------------------
1asyA2          DLKNIRR---------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1wu7A2          FGXGDAVISLLLKRENVQ----------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1r8gA           Q-QFEALFRCLSYTTXIDSIKDLHWDIRPSPHFGTVEV--------------------------------
1usyA           ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1o6dA           VRKETEDLTNRILPGSFVMVMDKRSEEFADFLKDLEMKGKDITILIGGPYGLNEEIFAKAHRVFSLSKMT
1n4kA1          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1evkA1          QSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMD
1gc5A           ----------------------------------------------------------------------
1c0aA3          MTEPSFANPTALAELSIQV---------------------------------------------------
1h4qA1          SRERVLEAAQGLRAQGLRVHLDDRDQHTGYKFHEWELKGVPFRVELGPKDLEGGQAVLARLGGKET----
1g5hA1          LRQVCQGLLNELLENGISVWPETVHSSLEQLHSKYDEXSVLFSVLVTETTLENGLIQLRSRDTTXKEXXH
1v95A           TKDYAESVGRKVRDLGMVVDLIFLNTELSQALEDVSRGGSPFAIVITQQHQIHRSCTVMFGTPQEHRNMP
1wu7A1          NSSIXNEYSRKLRERGXNVTVEIXERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNXYTGSQENVG
1adjA1          AVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLS
1httA1          TQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVA
1nyqA2          ----------------------------------------------------------------------
1atiA1          ITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQDTVTVRDRDTMEQIRLH
1qe0A1          ADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIE
1qf6A2          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1e1cB2          FGGREGFSSPVWHIAGIDT-PQVEGGTTAEIVEAFKKSGAQVADLCSSAKVYAQQG--------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1g6sA           SKPYIDITLNLMKTFGVEIENQHYQQ---FVVKGGQSYQSPGTYLVEGAAIKGGTVKVTGIGRNSM----


                         .         +         .         .         .         .         *:700
query           KAEFKNLLFEDIENYSREK
1evkA2          -------------------
1asyA2          -------------------
1atiA2          -------------------
1serA2          -------------------
1adjA2          -------------------
1nyqA3          -------------------
1wu7A2          -------------------
1h4qA2          -------------------
1r8gA           -------------------
1usyA           -------------------
1v4pA           -------------------
1o6dA           FTHGMTVLIVLEQIF----
1n4kA1          -------------------
1b70A           -------------------
1z7mA1          -------------------
1evkA1          VNEVIEKLQQEIRSRSLK-
1gc5A           -------------------
1c0aA3          -------------------
1h4qA1          -------------------
1g5hA1          ISKLRDFLVKYLASASN--
1v95A           QADAMVLVARNYERYKNEC
1wu7A1          LDSVVEHLISQA-------
1adjA1          REEVPGYLLQAL-------
1httA1          QDSVAAHLRTLL-------
1nyqA2          -------------------
1atiA1          VDELEGFLRERLR------
1qe0A1          LDAL---------------
1qf6A2          -------------------
1rwsA           -------------------
1k8kD1          -------------------
1zud21          -------------------
1vjkA           -------------------
1gw6A1          -------------------
1wxqA2          -------------------
1tygB           -------------------
1e1cB2          -------------------
2hj1A1          -------------------
1fm0D           -------------------
1g6sA           -------------------