[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hh2P4.bssp"
#ERROR : Can't open dsspfile "1k0rA4.bssp"
#ERROR : Can't open dsspfile "1m98A1.bssp"
#ERROR : Can't open dsspfile "1hh2P2.bssp"
#ERROR : Can't open dsspfile "1k0rA1.bssp"
#ERROR : Can't open dsspfile "2nn6I1.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1wi5A.bssp"
#ERROR : Can't open dsspfile "1hh2P3.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "1go3E1.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "1x4mA1.bssp"
#ERROR : Can't open dsspfile "1x4nA1.bssp"
#ERROR : Can't open dsspfile "1j4wA1.bssp"
#ERROR : Can't open dsspfile "2cteA1.bssp"
#ERROR : Can't open dsspfile "1dt4A.bssp"
#ERROR : Can't open dsspfile "2cpqA1.bssp"
#ERROR : Can't open dsspfile "1vigA.bssp"
#ERROR : Can't open dsspfile "2ctmA1.bssp"
#ERROR : Can't open dsspfile "2ctlA1.bssp"
#ERROR : Can't open dsspfile "2ctkA1.bssp"
#ERROR : Can't open dsspfile "1tuaA1.bssp"
#ERROR : Can't open dsspfile "1egaA2.bssp"
#ERROR : Can't open dsspfile "1k1gA.bssp"

## Summary of PDB Search
:375
    2e-35  48%  1hh2P4 [d.202.1.1] N UTILIZATION SUBSTANCE PROTEIN A P:1 -- 126
    7e-22  33%  1k0rA4 [d.202.1.1] NUSA A:-4 -- 99
    3e-20  15%  1m98A1 [a.175.1.1] ORANGE CAROTENOID PROTEIN A:2 -- 175
    3e-19  50%  1hh2P2 [d.52.3.1] N UTILIZATION SUBSTANCE PROTEIN A P:199 -- 276
    4e-17  31%  1k0rA1 [b.40.4.5] NUSA A:108 -- 183
    7e-15  11%  2nn6I1 [b.40.4.5] 3'-5' EXORIBONUCLEASE CSL4 HOMOLOG I:61 -- 185
    5e-13  38%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198
    6e-12  14%  1wi5A  [b.40.4.5] RRP5 PROTEIN HOMOLOG
    1e-11  60%  1hh2P3 [d.52.3.1] N UTILIZATION SUBSTANCE PROTEIN A P:277 -- 344
    3e-11  18%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730
    3e-11  14%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167
    3e-09  15%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3 --
    3e-09  15%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163
    7e-09  17%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171
    1e-08  16%  1go3E1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE SUBUNIT E E:79 -- 184
    2e-07  17%  1d7qA  [b.40.4.5] TRANSLATION INITIATION FACTOR 1A
    1e-06  18%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --
    3e-06  19%  1x4mA1 [d.51.1.1] FAR UPSTREAM ELEMENT BINDING PROTEIN 1 A:8 -- 88
    7e-06  20%  1x4nA1 [d.51.1.1] FAR UPSTREAM ELEMENT BINDING PROTEIN 1 A:8 -- 86
    9e-06  18%  1j4wA1 [d.51.1.1] FUSE BINDING PROTEIN A:1 -- 74
    9e-06  25%  2cteA1 [d.51.1.1] VIGILIN A:8 -- 88
    1e-05  23%  1dt4A  [d.51.1.1] NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
    1e-05  27%  2cpqA1 [d.51.1.1] FRAGILE X MENTAL RETARDATION SYNDROME RELATED
    1e-05  16%  1vigA  [d.51.1.1] VIGILIN
    2e-05  15%  2ctmA1 [d.51.1.1] VIGILIN A:8 -- 88
    3e-05  16%  2ctlA1 [d.51.1.1] VIGILIN A:8 -- 91
    1e-04  20%  2ctkA1 [d.51.1.1] VIGILIN A:8 -- 98
    1e-04  31%  1tuaA1 [d.51.1.1] HYPOTHETICAL PROTEIN APE0754 A:1 -- 84
    9e-04  17%  1egaA2 [d.52.3.1] PROTEIN (GTP-BINDING PROTEIN ERA) A:183 -- 295
    9e-04  21%  1k1gA  [d.51.1.1] SF1-BO ISOFORM
:375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKXXXXXXXXXXVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEVYD
1hh2P4          MNIGLLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLEVVEEVED
1k0rA4          --------------DRGISVNELLETIKSALLTAYRHTQGHQTDARIEIDRKTGVVRVIARETDEAGN--
1m98A1          -------------------------------------------------DTARSIFPETLAADVVTIARF
1hh2P2          ----------------------------------------------------------------------
1k0rA1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1hh2P3          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
1x4mA1          ----------------------------------------------------------------------
1x4nA1          ----------------------------------------------------------------------
1j4wA1          ----------------------------------------------------------------------
2cteA1          ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
2cpqA1          ----------------------------------------------------------------------
1vigA           ----------------------------------------------------------------------
2ctmA1          ----------------------------------------------------------------------
2ctlA1          ----------------------------------------------------------------------
2ctkA1          ----------------------------------------------------------------------
1tuaA1          ----------------------------------------------------------------------
1egaA2          ----------------------------------------------------------------------
1k1gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTG
1hh2P4          PATQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKE----------------
1k0rA4          --------------------LISEWDDTPEGFGRIAATTARQVMLQRFRDAE------------------
1m98A1          KQLSAEDQLALIWFAYLEMGKTITIAAPGAANMQFAENTLQE-IRQMTPLQQTQAMCDLANRTDTPICRT
1hh2P2          ----------------------------------------------------------------------
1k0rA1          -------------------------------------------------------------TREGEIVAG
2nn6I1          ---------------------------------------------------------SQLLPDVGAIVTC
1hh2P1          --------------------------------------------------------FEKYSELKGTVTTA
1wi5A           -------------------------------------------SGSSGKNVNRVLSAEAL--KPGMLLTG
1hh2P3          ----------------------------------------------------------------------
2oceA4          ------------------------------------------------KTAEFQEGVESLKDLKPMVLEG
2nn6H1          ----------------------------------------------------------RYIGEVGDIVVG
1kl9A2          ----------------------------------------------------SCRFYQHKFPEVEDVVXV
1k3rA1          -----------------------------------------------------------GKPVTGEYRQG
1y14B1          -----------------------------------------------------------------EVVDG
1go3E1          -----------------------------------------------------------------ELIEG
1d7qA           ---------------------------------------------RRRGKNENESEKRELVFKEDGQEYA
2ba0A1          -----------------------------------------------------------YTPSVGDVVIG
1x4mA1          ----------------------------------------------------------------------
1x4nA1          ----------------------------------------------------------------------
1j4wA1          ----------------------------------------------------------------------
2cteA1          ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
2cpqA1          ----------------------------------------------------------------------
1vigA           ----------------------------------------------------------------------
2ctmA1          ----------------------------------------------------------------------
2ctlA1          ----------------------------------------------------------------------
2ctkA1          ----------------------------------------------------------------------
1tuaA1          ----------------------------------------------------------------------
1egaA2          ----------------------------------------------------------------------
1k1gA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQ
1hh2P4          ----------------------------------------------------------------------
1k0rA4          ----------------------------------------------------------------------
1m98A1          YASWSPNIKLGFWYELGRFMDQGLVAPIPEGYKLSANANAILVTIQGIDPGQQITVLRNC--VVDMGFDT
1hh2P2          -----------------------------------------------------------VPEFVIGLMKL
1k0rA1          VIQRDSRALVVVRIGTSEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSR------------
2nn6I1          KVSSINSRFAKVHILYVGSMPLKDKVEIYKSFRPGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHSES
1hh2P1          EVIRVMGEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKTTKGPKILVSR------------
1wi5A           TVSSLEDHGYLVDIGVLKAQEYIRQKNKGAKLKVGQYLNCIVEKVKGNGGVVSLSVGHSEVSTAIATEQQ
1hh2P3          ----------------------------------------------------------------------
2oceA4          VVTNVTNFGAFVDIGVHQDGLVHISALPYEVVKAGDIVKVKVMEVDIPRNRVGLSMRMSDT---------
2nn6H1          RITEVQQKRWKVETNSRLDSVLLLSSMMRGFLQEGDLISAEVQAVF---SDGAVSLHTRSLKYGK-----
1kl9A2          NVRSIAEXGAYVSLLEYNNIE---GXILLSELRIGRNECVVVIRVDKEKGYIDLSKRR------------
1k3rA1          LTVKRVKKGTLVDIGA------DKLALCREKLTVNRIMSFRVVRL-----GKEILIEPDEP---------
1y14B1          TVVSCSQHGFEVQVGPMKVFVTASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGA-----
1go3E1          EVVDVVEFGSFVRLGPLDGLIHVSQKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEE
1d7qA           QVIKLGNGRLEAMCFDGVKRLCHIRGKLRKWINTSDIILVGLRDYQDNKA--DVILKYNADEARSLKAYG
2ba0A1          IIREVAANGWAVDIYSYQAFLPVSEKKPNEVLDIGDAIIAKVLNIDPKMK--------------------
1x4mA1          ----------------------------------------------------------------------
1x4nA1          ----------------------------------------------------------------------
1j4wA1          ----------------------------------------------------------------------
2cteA1          ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
2cpqA1          ----------------------------------------------------------------------
1vigA           ----------------------------------------------------------------------
2ctmA1          ----------------------------------------------------------------------
2ctlA1          ----------------------------------------------------------------------
2ctkA1          ----------------------------------------------------------------------
1tuaA1          ----------------------------------------------------------------------
1egaA2          ------------------------------------------------------MASEIIREKLMRFLGA
1k1gA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWxEDPA
1hh2P4          ----------------------------------------------------------------------
1k0rA4          ----------------------------------------------------------------------
1m98A1          SKLGSYQR--------------------------------------------------------------
1hh2P2          EIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKW-----
1k0rA1          ----------------------------------------------------------------------
2nn6I1          GIQMVPISWCEMQCPKTHTKEFRKV---------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1wi5A           WNLNNLSGPSS-----------------------------------------------------------
1hh2P3          ------------------------------------------------------------------DDPK
2oceA4          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1d7qA           ELPEHAK---------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
1x4mA1          ----------------------------------------------------------------------
1x4nA1          ----------------------------------------------------------------------
1j4wA1          ----------------------------------------------------------------------
2cteA1          ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
2cpqA1          ----------------------------------------------------------------------
1vigA           ----------------------------------------------------------------------
2ctmA1          ----------------------------------------------------------------------
2ctlA1          ----------------------------------------------------------------------
2ctkA1          ----------------------------------------------------------------------
1tuaA1          ----------------------------------------------------------------------
1egaA2          ELPYSVT--VEIERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEA---------------
1k1gA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EYIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNV
1hh2P4          ----------------------------------------------------------------------
1k0rA4          ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
1hh2P2          ----------------------------------------------------------------------
1k0rA1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1hh2P3          QLIANALAPATVIEVEILDKENKAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDIKPIMN-------
2oceA4          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
1x4mA1          -----------------DGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQ------
1x4nA1          -----------------QQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSC
1j4wA1          ----------------------HMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIA
2cteA1          -------------DIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDP------
1dt4A           -------------------------EIAVPENLVGAILGKGGKTLVEYQELTGCRIQISKKGEFLPGTR-
2cpqA1          -------------------AAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDT-------
1vigA           -------------------NRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSE-------
2ctmA1          --------------IVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDP----
2ctlA1          -------------------LRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDD-------
2ctkA1          ------------------ALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPEL-------
1tuaA1          ------------------------IYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDTENS-------
1egaA2          ----------------------------------------------------------------------
1k1gA           ------------------DKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK---------


                         .         .         .         .         *         .         .:420
query           Exxxxxxxxxxxxxxxxxxxxxxxx
1hh2P4          -------------------------
1k0rA4          -------------------------
1m98A1          -------------------------
1hh2P2          -------------------------
1k0rA1          -------------------------
2nn6I1          -------------------------
1hh2P1          -------------------------
1wi5A           -------------------------
1hh2P3          -------------------------
2oceA4          -------------------------
2nn6H1          -------------------------
1kl9A2          -------------------------
1k3rA1          -------------------------
1y14B1          -------------------------
1go3E1          -------------------------
1d7qA           -------------------------
2ba0A1          -------------------------
1x4mA1          -------------------------
1x4nA1          M------------------------
1j4wA1          Q------------------------
2cteA1          -------------------------
1dt4A           -------------------------
2cpqA1          -------------------------
1vigA           -------------------------
2ctmA1          -------------------------
2ctlA1          -------------------------
2ctkA1          -------------------------
1tuaA1          -------------------------
1egaA2          -------------------------
1k1gA           -------------------------