[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99438.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7oA.bssp"

## Summary of PDB Search
:112
    3e-04  56%  1s7oA  [a.4.13.3] HYPOTHETICAL UPF0122 PROTEIN
:112

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
1s7oA           ---EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL


                         .         .         *         .         .         .         .:140
query           HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE
1s7oA           HMYSDY----VVRSEIFDDMIAHYPHDEYLQEKISILTSIDN