[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99450.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2i7tA1.bssp"
#ERROR : Can't open dsspfile "2i7xA1.bssp"
#ERROR : Can't open dsspfile "2dkfA1.bssp"
#ERROR : Can't open dsspfile "1qh3A.bssp"
#ERROR : Can't open dsspfile "1xm8A.bssp"
#ERROR : Can't open dsspfile "1p9eA.bssp"
#ERROR : Can't open dsspfile "1m2xA.bssp"
#ERROR : Can't open dsspfile "1smlA.bssp"
#ERROR : Can't open dsspfile "1ww1A1.bssp"
#ERROR : Can't open dsspfile "2az4A1.bssp"
#ERROR : Can't open dsspfile "1x8gA.bssp"
#ERROR : Can't open dsspfile "1t0hB.bssp"
#ERROR : Can't open dsspfile "2q0iA1.bssp"
#ERROR : Can't open dsspfile "2gmnA1.bssp"
#ERROR : Can't open dsspfile "1wraA1.bssp"
#ERROR : Can't open dsspfile "1bc2A.bssp"
#ERROR : Can't open dsspfile "1zkpA1.bssp"
#ERROR : Can't open dsspfile "2d0oB1.bssp"
#ERROR : Can't open dsspfile "1vjnA.bssp"
#ERROR : Can't open dsspfile "1y44A1.bssp"
#ERROR : Can't open dsspfile "1ztcA1.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "1vmeA2.bssp"
#ERROR : Can't open dsspfile "1a7tA.bssp"
#ERROR : Can't open dsspfile "1e5dA2.bssp"
#ERROR : Can't open dsspfile "1jt1A.bssp"
#ERROR : Can't open dsspfile "1eo0A.bssp"
#ERROR : Can't open dsspfile "1x3wA1.bssp"

## Summary of PDB Search
:565
    2e-46  14%  2i7tA1 [d.157.1.10] CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR
    4e-39   8%  2i7xA1 [d.157.1.10] PROTEIN CFT2 A:1 -- 422 A:626 -- 717
    2e-34  21%  2dkfA1 [d.157.1.10] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN A:1
    2e-29  16%  1qh3A  [d.157.1.2] PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)
    2e-28  14%  1xm8A  [d.157.1.2] GLYOXALASE II
    5e-24  10%  1p9eA  [d.157.1.5] METHYL PARATHION HYDROLASE
    2e-23  11%  1m2xA  [d.157.1.1] CLASS B CARBAPENEMASE BLAB-1
    3e-22  12%  1smlA  [d.157.1.1] PROTEIN (PENICILLINASE)
    3e-22  14%  1ww1A1 [d.157.1.7] TRNASE Z A:1 -- 280
    1e-20  15%  2az4A1 [d.157.1.10] HYPOTHETICAL PROTEIN EF2904 A:56 -- 238
    9e-19  13%  1x8gA  [d.157.1.1] BETA-LACTAMASE
    2e-18  14%  1t0hB  [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
    5e-18  16%  2q0iA1 [d.157.1.14] QUINOLONE SIGNAL RESPONSE PROTEIN A:1 -- 298
    2e-17  14%  2gmnA1 [d.157.1.1] METALLO-BETA-LACTAMASE A:29 -- 292
    1e-15  19%  1wraA1 [d.157.1.8] TEICHOIC ACID PHOSPHORYLCHOLINE ESTERASE/CHOLINE
    1e-15  21%  1bc2A  [d.157.1.1] METALLO-BETA-LACTAMASE II
    9e-13  20%  1zkpA1 [d.157.1.9] HYPOTHETICAL PROTEIN BA1088 A:1 -- 244
    1e-12   8%  2d0oB1 [c.51.3.2] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL B:5 --
    8e-12   7%  1vjnA  [d.157.1.4] ZN-DEPENDENT HYDROLASE OF METALLO-BETA-LACTAMASE
    1e-09  23%  1y44A1 [d.157.1.7] RIBONUCLEASE Z A:1 -- 307
    3e-09  25%  1ztcA1 [d.157.1.11] HYPOTHETICAL PROTEIN TM0894 A:1 -- 207
    7e-09  19%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
    2e-08  18%  1vmeA2 [d.157.1.3] FLAVOPROTEIN A:1 -- 250
    1e-07  24%  1a7tA  [d.157.1.1] METALLO-BETA-LACTAMASE
    1e-07  25%  1e5dA2 [d.157.1.3] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE A:2 -- 250
    1e-05  10%  1jt1A  [d.157.1.1] FEZ-1, CLASS B3 METALLO-BETA-LACTAMASE
    2e-04  15%  1eo0A  [a.48.3.1] TRANSCRIPTION ELONGATION FACTOR S-II
    8e-04  12%  1x3wA1 [d.3.1.4] PEPTIDE:N-GLYCANASE A:8 -- 327
:565

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
2i7tA1          -DQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMD------ALPYIDLIDPAEIDLLLISHF
2i7xA1          ---YKYNCCD-DGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYE------QCIKYWEKVIPEIDVIILSQP
2dkfA1          ----RIVPFGAAREVTGSAHLLLAGGRRVLLDCGXFQGKEEA-------RNHAPFGFDPKEVDAVLLTHA
1qh3A           ---MKVEVLPALTDN--YMYLVIDDETKEAAIVDPVQPQ----------KVVDAARKHGVKLTTVLTTHH
1xm8A           ---MQIELVPCLKDN--YAYILHDEDTGTVGVVDPSEAE----------PIIDSLKRSGRNLTYILNTHH
1p9eA           ---LAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGLFGP--TLGRLAANLKAAGYQPEQVDEIYITHM
1m2xA           ---YTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKS-------FTDEIYKKHGKKVIMNIATHS
1smlA           -----------IGTEDLTALLVQTPDGAVLLDGGMPQ------MASHLLDNMKARGVTPRDLRLILLSHA
1ww1A1          -----------------FSTWIYYSPERILFDAGEGVST--------------TLGSKVYAFKYVFLTHG
2az4A1          -----------------NNRLV--PELKDLYDPRL-------------GYEYHGAEDKDYQHTAVFLSHA
1x8gA           ----PVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIK-------RVSRKPVLEVINTNY
1t0hB           ----------------------------------------------------------------------
2q0iA1          -----------------VFLLRLGEASWALVEGGISR------DAELVWADLCRWVADPSQVHYWLITHK
2gmnA1          -----------VGTDGIAVYVIKTSQGLILMDTAMPQ------STGMIKDNIAKLGFKVADIKLILNTHA
1wraA1          ----------NVQEGGSDAIILESNGHFAMVDTGEDYDFPDGSDSVLTDRVFRRLKESVQKLDFILVTHT
1bc2A           -----------------NGLVLNTSKGLVLVDSSWDDKLTKEL-IEMVE------KKFQKRVTDVIITHA
1zkpA1          -------FWGGFPEAGEATYLFEHDGFRLLVDCG---SGVLAQLQKYITPS---------DIDAVVLSHY
2d0oB1          -----------------------------------------------------------------IAIAV
1vjnA           -----------------ACFALEXEGKTIVTDPFDP--------------------IPNVTADVVTESHQ
1y44A1          ----ELLFLGGIPAKARNVVALKLLEEVWLFDCGEATQHQXLTTIKP------------RKIEKIFITHX
1ztcA1          ---LKILVTGGLNAHFSTVVYLEHKDRRIIIDPGNLSSXDELEEK------FSELGISPDDITDVLFTHV
2cfuA2          -----IYQVRGFDLA--NITFIRGDSGWIVVDTLTTPATARAA------YELVSRELGERPIRTVIYSHA
1vmeA2          -----------------NAYLVKLNGANVLIDGWKGNYAKEFIDLSKIV--------DPKEITHIIVNHT
1a7tA           -----------------------------------------------------------AKVTTFIPNHW
1e5dA2          -----------------NAYLVE-DEKTTLFDTVAEYKGELLCGIASVIDP--------KKIDYLVIQHL
1jt1A           ----------------------------------------------------------------LLISHA
1eo0A           ----------------------------------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
2i7tA1          HLDHCGALPWFLQKTSFKGRTFMTHATKYVKLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHV-
2i7xA1          TIECLGAHSLLYYNFTSHFIATLPVINLGRVSTIDEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVC
2dkfA1          HLDHVGRLPKLFREYRGPVYATRATVLLXEIVLEDPEDVEELGHLRPLEYGEWLRLGALSLAFGQAGH-L
1qh3A           HWDHAGGNEKLVKLESGLKVYGGDD--------------RIGALTHKITHLSTLQVGSLNVKCLATPCHT
1xm8A           HYDHTGGNLELKDRYGAKVI------------GSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHT
1p9eA           HPDHVGGLMVGEQLPNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNDLVPGIKALASHGHT
1m2xA           HDDRAGGLEYFGKIGAKTYSTK------MTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTA
1smlA           HADHAGPVAELKRRTGAKVAANAESAVLLALHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHT
1ww1A1          HVDHIAGLWGVVNIRNNGMGDREKPLDVFYPEGNRAVEEYTEDLRFSFNVHPLKEGERVFLRNAGGFKRY
2az4A1          HLDHSRMINYLDPAVPLYTLKETKMILGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDA
1x8gA           HTDRAGGNAYWK-SIGAKVVSTRQTRDLMKSDWAEEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHT
1t0hB           ----------------------------------------------------------------------
2q0iA1          HYDHCGLLPYLCPRPNVQVLASERTCQAWKSESAVACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHS
2gmnA1          HLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKEGDRVTLGDTTLTAHATPGHS
1wraA1          HSDHIGNVDELLSTYVDRVYLKKYSDSRITNSERLWDNLYGYDIQNITQGDAHFQFGDMDIQLYNYENET
1bc2A           HADRIGGIKTL-KERGIKAHSTALTAELAKKNGYEEP-------LGDLQTVTNLKFGNMKVETFYPGKGH
1zkpA1          HHDHVADIGVLQYLPELPIYGHTFDENGFH-----SLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPV
2d0oB1          IDGCDGLWREVLLGIEEEGIPFR--------------LQHHPAGEVVDSAWQAARSS---PLLVGIACDR
1vjnA           HNAHHLVKGNFRVIDRPGA-----------YTVNGVKIKGVETFHDGKNIVFVFEGEGIKVCHLGDLGHV
1y44A1          HGDHVYGLPGLLGEDELTVYGPKGIKAFIETSLAVTKTHLTYPAIQEIEEGIVFEDDQFIVTAVSVIHGV
1ztcA1          HLDHIFNSVLFENAYVHEVYKTKNYLSFGTIVGRIYS-KVISSWKNVVLLKGEESLFDEKVKVFHTPWHA
2cfuA2          HADHFGGVRGLVEPQQVASG--------------------------------------------------
1vmeA2          EPDHSGSLPATLKT-----IGHDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVXT----
1a7tA           HGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGLPVPE-------HGFTDSLTVSLDGMPLQCYYLGHA-
1e5dA2          ELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKD-----WPVQVVKHGETLSLGKRTVTFYETRMHW
1jt1A           HFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDDSSTYFTQSKVLHDGERVELGGTVLTAHLTPHT-
1eo0A           ----------------------------------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTEIGREGVLALLSESANAENPRETVNERAIYD
2i7tA1          LGAAMFMIEIAGVKLLYTGDFSRQMAAEIPNI----------KPDILIIESTYGTHIHEKREEREARFCN
2i7xA1          PGGSIWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKI
2dkfA1          PGSAFVVAQGEGRTLVYSGDL--------GNREKDVLPDPSLPPLADLVLAEGTYGDRPHRPYRETEFLE
1qh3A           SGHICYFVSKPGGPAVFTGDTLFVAGCGKFYEGTADEMCKALLE-VLGRLPPDTRV-YCGHEYTINNLKF
1xm8A           KGH--ISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQK-ITSLPDDTSIYCGHEYTLSNSKF--
1p9eA           PGHTTYVVESQGQKLALLGDLILVAADDPSVTTQLDSDSKSVAVERKKAFADAA----------------
1m2xA           D---NVVVWFPKEKVLVGGCIIKSADSKDYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQ
1smlA           PGSTAWTWTDTRNVRIAYADSLS-----------------------------------------------
1ww1A1          VQPFRTKSEVSFGYHIFEVRRKFVTEEYHKKVGDSLALDPEEIRGTELLIHECTFLDARDNHAAIDEVME
2az4A1          YGASALLIRTPDHFITYTGDLRLH-----GHNREETLAFCEKAKHTELLMMEGVSISFPEREPDPAQIAV
1x8gA           PDG--IFVYFPDEQVLYGNCILKEKLGNLSFADVKAYPQTL--ERLKAMKLPI-----------------
1t0hB           -----------------------------------------------------VGPSLKGYEVTDXXQKA
2q0iA1          DD--HVVFYDVRRRRLFCGDALGEFD--------------------------------------------
2gmnA1          PGCTSWEMTVKDGKEDREVLFFCS----------------------------------------------
1wraA1          DSSLISVVKVNGKKIYLGGDLDNVHGAEDKYG--------------------------------------
1bc2A           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEW-STSIENVLKRYRNIN-------------
1zkpA1          T-CFAXRITAGNDIVVYSADSSYIPEFIPFTK--------------------------------------
2d0oB1          HMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARL--------------------------------
1vjnA           LTPAQVEEIGEIDVLLVPVGGTYTIGPK-----EAKEVADLLNAKVIIPXHYKTKYLKFNLLPVDDFL--
1y44A1          -EAFGYRVQEKDRSVVFSGDTRVS----------------------------------------------
1ztcA1          REHLSFLLDTENGRVLITGD--------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           TDNIVVWLPTE--NILFGGCMLKDNQT-------------------------------------------
1e5dA2          PDSMVSWFADE--KVLISNDI-------------------------------------------------
1jt1A           RGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYK--------------------------------------
1eo0A           ----------------------------------------------------------------------
1x3wA1          ------------------------------NKPDCNHCGQNTSENXTPLGSQGPNGEESKFNCG--TVEI


                         .         .         .         +         .         .         .:280
query           FISENFEYRKGRIIVACVASNILRVQQIFNAAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPI
2i7tA1          TVHDIVNRGGRGLIPV---FALGRAQELLLILDEYWQNHPELHDIPIYYAFKHISNLK------------
2i7xA1          FTLKKGLSSDGSVIIPVDMSGKFLDLFTQVHELLFESQVPVLILSYARGRTLTYNNTSPFEIGSRIKIIA
2dkfA1          ILEKTLS-QGGKVLIPTFAVE--RAQEILYVLYTHGHRIYLDSPXAGRVLSLYPRLAHFLQGKNPFRPAG
1qh3A           ARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMR-AVRRE
1xm8A           ALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADE-AEALGII
1p9eA           ----------------------------------------------------------------------
1m2xA           HTLDLINEYQQK----------------------------------------------------------
1smlA           ----------------------------------------------------------------------
1ww1A1          SVK---AAGVKKVILYHISTRYIQLKSVIKKYREEMPDVEILYMDPRKVFE-------------------
2az4A1          VSEE------------------------------------------------------------------
1x8gA           ----------------------------------------------------------------------
1t0hB           LFDFLKHRFEGRISITRVTADISLAKAII-ERSNTRSSLAEVQSEIERIFELARTLQLVVLD-ADTINHP
2q0iA1          ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------
1wraA1          ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2d0oB1          ----------------------------------------------------------------------
1vjnA           ------KLFDSYERVG------------------------------------------------------
1y44A1          ----------------------------------------------------------------------
1ztcA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1e5dA2          ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
1eo0A           --------------------------------------------DSKEVLVHVKNLEKNKSNDAAVLEIL
1x3wA1          YKCNRCGNI-TRFPRYNDPIKLLETRKGRCGEWCN-----------------------------------


                         .         *         .         .         .         .         +:350
query           KKINDYNDDEIVILETGRSGEPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSG
2i7tA1          -----SMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVEGTLAKIMSEPEEITTMS
2i7xA1          PNELSKYPGSKICFVSEVGALINEVIIKVGNSEKTTLSIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRT
2dkfA1          LEVVEHTEASKALNRAPGPXVVLAGSGXLAGGRHHLKHGPRNALVFPQGGLGAEIIARPPAVR--ILGEE
1qh3A           KDQFKMPRD-------------------------------------------------------------
1xm8A           RKAKD-----------------------------------------------------------------
1p9eA           ----------------------------------------------------------------------
1m2xA           ----------------------------------------------------------------------
1smlA           ----------------------------------------------------------------------
1ww1A1          ----------------------------------------------------------------------
2az4A1          ----------------------------------------------------------------------
1x8gA           ----------------------------------------------------------------------
1t0hB           AQLSKTSLAPIIVYVKISSPKV---LQRLIKSRHLNVQXVAADKL---AQCPPQESFDVILDENQLEDAC
2q0iA1          ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------
1wraA1          ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2d0oB1          ----------------------------------------------------------------------
1vjnA           ----------------------------------------------------------------------
1y44A1          ----------------------------------------------------------------------
1ztcA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1e5dA2          ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
1eo0A           HVLDKEFVPTEKLLRETKVGVEVNKFKK------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
2i7tA1          GQKLMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHNPRNTEAVT
2i7xA1          ISTKCSVVILNLQSLVDQRSASIIWPSLKSRKIVLSAPKQIQNEEITAKLIKKNI---EVVNMPLNKIVE
2dkfA1          VPLRASVHTLGGSGHAGQDEL---LDWLQEPRVVLVHGEEEKLLA---LGKLLALRGQEVSLARFGE---
1qh3A           ----------------------------------------------------------------------
1xm8A           ----------------------------------------------------------------------
1p9eA           ----------------------------------------------------------------------
1m2xA           ----------------------------------------------------------------------
1smlA           ----------------------------------------------------------------------
1ww1A1          ----------------------------------------------------------------------
2az4A1          ----------------------------------------------------------------------
1x8gA           ----------------------------------------------------------------------
1t0hB           EHLADYLEAWKATHPPR-----------------------------------------------------
2q0iA1          ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------
1wraA1          ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2d0oB1          ----------------------------------------------------------------------
1vjnA           ----------------------------------------------------------------------
1y44A1          ----------------------------------------------------------------------
1ztcA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1e5dA2          ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
1eo0A           ----------------------------------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           Yxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7tA1          L---------------------------------------------------------------------
2i7xA1          ----------------------------------------------------------------------
2dkfA1          ----------------------------------------------------------------------
1qh3A           ----------------------------------------------------------------------
1xm8A           ----------------------------------------------------------------------
1p9eA           ----------------------------------------------------------------------
1m2xA           ----------------------------------------------------------------------
1smlA           ----------------------------------------------------------------------
1ww1A1          ----------------------------------------------------------------------
2az4A1          ----------------------------------------------------------------------
1x8gA           ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
2q0iA1          ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------
1wraA1          ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2d0oB1          ----------------------------------------------------------------------
1vjnA           ----------------------------------------------------------------------
1y44A1          ----------------------------------------------------------------------
1ztcA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1e5dA2          ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
1eo0A           ----------------------------------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7tA1          ----------------------------------------------------------------------
2i7xA1          ----------------------------------------------------------------------
2dkfA1          ----------------------------------------------------------------------
1qh3A           ----------------------------------------------------------------------
1xm8A           ----------------------------------------------------------------------
1p9eA           ----------------------------------------------------------------------
1m2xA           ----------------------------------------------------------------------
1smlA           ----------------------------------------------------------------------
1ww1A1          ----------------------------------------------------------------------
2az4A1          ----------------------------------------------------------------------
1x8gA           ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
2q0iA1          ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------
1wraA1          ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2d0oB1          ----------------------------------------------------------------------
1vjnA           ----------------------------------------------------------------------
1y44A1          ----------------------------------------------------------------------
1ztcA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1vmeA2          ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1e5dA2          ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
1eo0A           ----------------------------------------------------------------------
1x3wA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxx
2i7tA1          -----
2i7xA1          -----
2dkfA1          -----
1qh3A           -----
1xm8A           -----
1p9eA           -----
1m2xA           -----
1smlA           -----
1ww1A1          -----
2az4A1          -----
1x8gA           -----
1t0hB           -----
2q0iA1          -----
2gmnA1          -----
1wraA1          -----
1bc2A           -----
1zkpA1          -----
2d0oB1          -----
1vjnA           -----
1y44A1          -----
1ztcA1          -----
2cfuA2          -----
1vmeA2          -----
1a7tA           -----
1e5dA2          -----
1jt1A           -----
1eo0A           -----
1x3wA1          -----