[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99526.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fj6A1.bssp"
#ERROR : Can't open dsspfile "2o6kA1.bssp"

## Summary of PDB Search
:75
    3e-10  50%  2fj6A1 [a.60.15.1] HYPOTHETICAL UPF0346 PROTEIN YOZE A:1 -- 74
    3e-08  38%  2o6kA1 [a.60.15.1] UPF0346 PROTEIN MW1311 A:4 -- 73
:75

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
2fj6A1          ----KSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQY
2o6kA1          -----SFYQFVXTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPXSVFDDLYEEY


                         .         .         *         .         .         .         .:140
query           EExxx
2fj6A1          ES---
2o6kA1          TE---