[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "2apoA2.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1k8wA5.bssp"
#ERROR : Can't open dsspfile "1kskA4.bssp"
#ERROR : Can't open dsspfile "1ze2B2.bssp"
#ERROR : Can't open dsspfile "1s72A1.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"
#ERROR : Can't open dsspfile "1vioA2.bssp"
#ERROR : Can't open dsspfile "1h3eA2.bssp"
#ERROR : Can't open dsspfile "1p9kA.bssp"
#ERROR : Can't open dsspfile "1jh3A.bssp"
#ERROR : Can't open dsspfile "1kskA3.bssp"

## Summary of PDB Search
:298
    3e-60  39%  1v9kA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    8e-59  40%  1przA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    4e-39  14%  2apoA2 [d.265.1.2] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:17 --
    1e-33  15%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    3e-33  15%  1k8wA5 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:9 -- 250
    2e-32  19%  1kskA4 [d.265.1.3] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    9e-29  14%  1ze2B2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B B:1 -- 228
    2e-28  13%  1s72A1 [b.34.5.3] 50S RIBOSOMAL PROTEIN L2P A:91 -- 237
    3e-13  17%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    3e-12  22%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
    5e-10  40%  1vioA2 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE
    8e-10   8%  1h3eA2 [d.66.1.4] TYROSYL-TRNA SYNTHETASE A:352 -- 432
    4e-09  19%  1p9kA  [d.66.1.6] ORF, HYPOTHETICAL PROTEIN
    1e-08  15%  1jh3A  [d.66.1.4] TYROSYL-TRNA SYNTHETASE
    1e-06  22%  1kskA3 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
1v9kA           ----------------------------------------------------------------------
1przA           ---------------------------------------------------------------------F
2apoA2          ------------------------------------------------------------GCNPYERKIE
1r3eA2          ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
1kskA4          ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1s72A1          ----------------------------------------------------------------------
1dm9A           ------------RLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVI
1fjgD           VTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRVDLPSYRVRPGDEIAVAKSRNLELIR
1vioA2          ------------RLDKFIAENV-GLTRSQATKAIRQSAVKINGEVKSGSVQISQEDEIYFE---------
1h3eA2          ------------WVARLFTLAGLTPSNAEARRLIQNRGLRLDGELTDPMLQVDLSRPRILQRGKDRFVRV
1p9kA           -----LGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAETRKRCKIVAGQTVSFAGHSVQVVA-
1jh3A           ------------PLVELLVSAGISPSKRQAREDIQNGAIYVNGELQDVGAILTAEHRLEGRFTVIRR---
1kskA3          ------------RLDKFIAQQL-GVSRAIAGREIRGNRVTVDGEVRNAAFKLLPEHDVAYDGNPLAQ---


                         .         .         *         .         .         .         .:140
query           EPENIPLXXXXXXXXXXXXNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
1v9kA           -------------------NKPSGTAVHGGSGLSFGVIEGLRALR------PEARFLELVHRLDRDTSGV
1przA           EPQDIPLDIVYEDEDIIVINKPRDLVVHPGAGNPDGTVLNALLHY--YPPIADVPRAGIVHRLDKDTTGL
2apoA2          DLIK---------YGVVVVDKPRGPTSHEVSTW--------------VKKILNLDKAGHGGTLDPKVTGV
1r3eA2          -------------------YKPKGPTSHDVVDEVRKKL--------------KTRKVGHGGTLDPFACGV
1k8wA5          -------------------DKPQGMSSNDALQKVKRIY--------------NANRAGHTGALDPLATGM
1kskA4          -------------------NKPQGYVCSTDDPD-HPTVLYFLDEPVA-------WKLHAAGRLDIDTTGL
1ze2B2          -------------------YKPKGPTSHDVVDEVRKKL--------------KTRKVGHGGTLDPFACGV
1s72A1          ----------------------------------------------PLAEIP---EGVPVCNVESSPGDG
1dm9A           VKAITEQRRPASEAALLYEETAESVEKR------------------------------------------
1fjgD           QNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVQENL---------------------------
1vioA2          ----------------------------------------------------------------------
1h3eA2          RLS-------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
1v9kA           LLVAKKRSALRSLHEQLREKGXQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKV
1przA           XVVAKTVPAQTRLVESLQRREITREYEAVAIGHXTAG-GTVDEPISRHPTKRTHXAVHPXGKPAVTHYRI
2apoA2          LPVALERATKTIPMWHIPPKE----YVCLMHLHRDASEEDILRVFKEFTGRIYQ-----RRIRKIHELEL
1r3eA2          LIIGVNQGTRILEFYKDLKKV----YWVKMRLGLITETFDITGEVERLYKLAREGKIINLPPKRVKIFKI
1k8wA5          LPICLGEATKFSQYLLDSDK----RYRVIARLGQRTDTSDADGQIVEERPVTFSA---------------
1kskA4          VLXTDDGQWSHRI--TSPRHHCEKTYLVTLESPVADD-----------TAEQFAKGVQLHNEKDLTKPAV
1ze2B2          LIIGVNQGTRILEFYKDLKKV----YGEYDQVPPAYSAKKYKGERLY--------------KLAREGKII
1s72A1          GKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGV--
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
1v9kA           EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDEAGTGLNRLFLHAAALKFTHPGTGEVXRI
1przA           XEHFRVHTRLRLRLETGRTHQIRVHXAHITHPLVGDPVYGISTLRKFDRQALHATXLRLYHPISGIEXEW
2apoA2          LDKD--GKDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQ-ELRRTKSGCFEEKDAVYLQDLLDAYVFWK
1r3eA2          WDVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELV-----RESVGPHTIEESLNVFEAAPEE
1k8wA5          -----EQLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQIEVPREARPITVYELLFIRHEGNELEEI
1kskA4          LEVITPT-QVRLTISEGRYHQVKRXFAAVGNHVVELHRER------------------------------
1ze2B2          NLPPKRVKIFKIRVEVSPGTYIRVRESVGPHTIEESLNVFEAAP-EEIENRIIPLEKCL-----------
1s72A1          ------AMNAVDHPFGGGGRQHP------GKPKSISRNAPPGRKVG-DIASKRTGRGG------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1vioA2          ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TAPLPENFKKLLESLDKR
1v9kA           EAPXDEGLKRCLQ-----
1przA           HAPIPQDXVELIEVXRAD
2apoA2          EDGDEEELRRVIKPMEY-
1r3eA2          IENRIIPLEKCLE-----
1k8wA5          HCSKGTYIRTIIDDLGE-
1kskA4          ------------------
1ze2B2          ------------------
1s72A1          ------------------
1dm9A           ------------------
1fjgD           ------------------
1vioA2          ------------------
1h3eA2          ------------------
1p9kA           ------------------
1jh3A           ------------------
1kskA3          ------------------