[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99672.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"

## Summary of PDB Search
:375
    9e-32   9%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    2e-28  18%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    3e-27   7%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    3e-26  10%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    1e-22  17%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    2e-20  12%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    1e-18  12%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    7e-18  22%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    1e-11  13%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    2e-04  16%  1surA  [c.26.2.2] PAPS REDUCTASE
:375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPY
1jgtA1          ----------------------AACAHRAAGELDTVSMGTDTS----------NEFREARAVVDHLRTRH
1xngA1          ----------------------GVLCQKVFKENAHALLMP-------SSVSMPENKTDALNLCEKFSIPY
1q15A1          ----------------------TALASRHFKKLNTYSIGTELS----------NEFEFSQQVADALGTHH
1k92A1          ----------------------LLWMRQKGAVPYAYTANLG--------QPDEEDYDAIPRRAMEYGAEN
2c5sA1          ----------------------AYLTMKRGVSVEAVHF-------HSPPFTSERAKQKVIDLAQELTKYC
1ni5A1          ----------------------LHQLVQWRTENPGVALRAIHVHHGLS-ANADAWVTHCENVCQQWQVPL
1wy5A1          -----------------------DVLLKLKNYFSLKEVALAHFNHMLR-ESAERDEEFCKEFAKERNMKI
1gpmA1          ----------------------AMLLHRAIGKNLTCVFVDN------GLLRLNEAEQVLDMFGDHFGLNI
1vbkA1          -------------------------MMKRGVEVIPVYIGKD--------DKNLEKVRSLWNLLKRYSYGS
1surA           ----------------------LHLVNQIRPDIPVILT-------DTGYLF-PETYRFIDELTDKLKLNL


                         .         .         *         .         .         .         .:140
query           YSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRV
1jgtA1          REITIPTTELLAQLPYAVESVDPDIIEYLLPLTALYRALDGPERRILTGYGADIPLGGMHREDRLPALDT
1xngA1          TEYSIAP--YDAIFSSHFKDASLTRKGN---FCAR-LRMAFLYDYSLKSDSLVIGTSN------------
1q15A1          QMKILSETEV---INGIIESIYYNEIFDGLSAEIQSGLF--NVYRQAQGQVSCMLTGYGSPGAQYDNPNQ
1k92A1          ARKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYK-GNDIERFY
2c5sA1          KRVTLHLVPFTEVQKTINKEIP----SSYSMTVMRRMMMRITERIAEERNALAITTGESLG---------
1ni5A1          VVERVQLAQEGLGI----------------EAQARQARYQAFAR--TLLPGEVLVTAQHL---DDQCETF
1wy5A1          FVGKEDVRAFAKEN------------RMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLN-DLLETSLL
1gpmA1          VHVPAEDR--------FLSALAGENDPEAKRKIIGRVFVEVFDEEALLEDVKWLAQGT------------
1vbkA1          KGF-----------------------------LVVAESFDRVLKLIRDFGVKGVIKGLRP----------
1surA           YRATESAAWQEARYGKLWEQGVEGIE-----KYNDINKVEPMNRALKELNAQTWFAGL----RREQSGSR


                         +         .         .         .         .         *         .:210
query           HLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKF
1jgtA1          VLAHDMATFDGLNEMSPVLSTLAGHWTTHPYW-----DREVLDLLVSLEAGLKRRHGRDKWVLRAAMADA
1xngA1          ---------KSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKLNKPPSADLFVGQSDEKDL
1q15A1          LLAEQVYRTRWTGEFATHGASCYGIDIRHPFW-----SHSLISLCHALHPDYKIFDNEVKNILREYADSL
1k92A1          RYGLLTNAELQ--------IYKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVE---------------
2c5sA1          ------QVASQTLDSMHTINEVTNYPVIRPLITMDKLEIIKIAEEIGTYDISIRPKREKANRFEYDFTPL
1ni5A1          LLALKRGSGPAGLSAXAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSY--DRNF---
1wy5A1          FFTRGTGLDGLIGF------LPKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSI--PRNR---
1gpmA1          ----IYPD---------VIESAAKMGLVEPLKELFKDEVRKIGLELGLPYDMLYR---------------
1vbkA1          ------NDLNSEVSEITEDFKMFPVPVYYPLIALPEEYIKSVKERLGL----------------------
1surA           ANLP------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLxxxxxxxxx
1jgtA1          LPAETVNRPSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGG----GRHPSEVDTDDVVRSV---------
1xngA1          GYPYSVIDP---LLKDIEALFQTKPIDTETLAQL------------------------------------
1q15A1          QLAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLSITDV----TPSQLKDLI------------------
1k92A1          ----------------------------------------------------------------------
2c5sA1          IDEAVANKETMVLQ--------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jgtA1          ----------------------------------------------------------------------
1xngA1          ----------------------------------------------------------------------
1q15A1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
2c5sA1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxx
1jgtA1          -------------------------
1xngA1          -------------------------
1q15A1          -------------------------
1k92A1          -------------------------
2c5sA1          -------------------------
1ni5A1          -------------------------
1wy5A1          -------------------------
1gpmA1          -------------------------
1vbkA1          -------------------------
1surA           -------------------------