[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99736.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yr0A1.bssp"
#ERROR : Can't open dsspfile "1yk3A1.bssp"
#ERROR : Can't open dsspfile "2fl4A1.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "2ae6A1.bssp"
#ERROR : Can't open dsspfile "2fsrA1.bssp"
#ERROR : Can't open dsspfile "1lrzA3.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "1xmtA.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "2fckA1.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "2ge3A1.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "1yreA1.bssp"
#ERROR : Can't open dsspfile "1ro5A.bssp"
#ERROR : Can't open dsspfile "1on0A.bssp"
#ERROR : Can't open dsspfile "2ozgA2.bssp"
#ERROR : Can't open dsspfile "1wwzA1.bssp"
#ERROR : Can't open dsspfile "2fiaA1.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "2hv2A2.bssp"

## Summary of PDB Search
:252
    3e-08  25%  1yr0A1 [d.108.1.1] PHOSPHINOTHRICIN ACETYLTRANSFERASE A:4 -- 166
    4e-07   9%  1yk3A1 [d.108.1.1] HYPOTHETICAL PROTEIN RV1347C/MT1389 A:10 -- 207
    4e-07  15%  2fl4A1 [d.108.1.1] SPERMINE/SPERMIDINE ACETYLTRANSFERASE A:1 -- 146
    8e-07  10%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    8e-07  17%  2ae6A1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 161
    9e-07  12%  2fsrA1 [d.108.1.1] ACETYLTRANFERASE A:4 -- 167
    1e-06  11%  1lrzA3 [d.108.1.4] FACTOR ESSENTIAL FOR EXPRESSION OF METHICILLIN
    2e-06  22%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
    2e-06  15%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    2e-06  12%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    4e-06  13%  1xmtA  [d.108.1.1] PUTATIVE ACETYLTRANSFERASE
    9e-06   2%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
    3e-05  19%  1nslA  [d.108.1.1] PROBABLE ACETYLTRANSFERASE
    5e-05  21%  2fckA1 [d.108.1.1] RIBOSOMAL-PROTEIN-SERINE ACETYLTRANSFERASE, A:1
    5e-05  14%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    6e-05  13%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    6e-05  13%  2ge3A1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:6 -- 169
    9e-05  15%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    9e-05  12%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    1e-04  18%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    1e-04  16%  1yreA1 [d.108.1.1] HYPOTHETICAL PROTEIN PA3270 A:11 -- 193
    2e-04   7%  1ro5A  [d.108.1.3] AUTOINDUCER SYNTHESIS PROTEIN LASI
    2e-04  17%  1on0A  [d.108.1.1] YYCN PROTEIN
    2e-04  18%  2ozgA2 [d.108.1.10] GCN5-RELATED N-ACETYLTRANSFERASE A:8 -- 290
    3e-04  13%  1wwzA1 [d.108.1.1] HYPOTHETICAL PROTEIN PH1933 A:1 -- 157
    3e-04  11%  2fiaA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 157
    5e-04  21%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    6e-04  15%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    6e-04  14%  2hv2A2 [d.108.1.10] HYPOTHETICAL PROTEIN A:2 -- 286
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yr0A1          ----------------------------------------------------------------------
1yk3A1          ----------------------------------------------------------------------
2fl4A1          ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
2ae6A1          ----------------------------------------------------------------------
2fsrA1          ----------------------------------------------------------------------
1lrzA3          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1xmtA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------
1nslA           ----------------------------------------------------------------------
2fckA1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1bobA           ----------------------------------------------------------------------
2ge3A1          ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1yreA1          ----------------------------------------------------------------------
1ro5A           ----------------------------------------------------------------------
1on0A           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1wwzA1          ----------------------------------------------------------------------
2fiaA1          ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
2hv2A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxEQVRKFTRYATLKDTKFDIPRLQLNIEKLPPEFQIHSIDANLYDQCL
1yr0A1          ----------------------------------------------------------------------
1yk3A1          ----------------------------------------DAEMLEWMNRPHLAAAWEYDWPASRWRQHL
2fl4A1          --------------------------------------------------------------ENLQVFAE
1u6mA           -----------------------QAIARLVLVILKDMELPILEEVSE--EQMIDLLAEATAYPTYYQRIL
2ae6A1          ----------------------------------------------------------------------
2fsrA1          --------------------------------------------------------AYRDFXASPRSTGV
1lrzA3          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ---------------------------------------------------------------NVFSHQL
1mk4A           ---------------------------------------------HMDIRTITSS-DYEMV-TSVLNEWW
1xmtA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------
1nslA           ----------------------------------------------------------------------
2fckA1          ----------------------------------------------------------------------
1z4eA1          ---------------------------------------------HVTIREATEGEQMVHMLADDVLGRK
1bobA           ----------------------------------------------------------------------
2ge3A1          ----------------------------------------------------------------------
1vhsA           ----------------------------------------DLEAV-VAIYNSTIASRXVTADTEPVTPED
2bswA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1yreA1          ----------------------------------------------------------------------
1ro5A           -----------------------------------------------------IDEMEIDGYDALSPYYM
1on0A           ----------------------------------------------------------------------
2ozgA2          ---------------------------------------------RFKYTKASQE-NIQQL-GNILEQCF
1wwzA1          ----------------------------------------------------------------------
2fiaA1          --------------------------------------------------------------LQFLTEVK
1tiqA           ----------------------------------------------------------------------
1s3zA           --------------------------------------------------------------RGLRKQLW
2hv2A2          ----------------------------------------------------------------LVIYAF


                         +         .         .         .         .         *         .:210
query           QKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQL
1yr0A1          ------------------------IVAILDGKVAGYASAFDGYRHTREHSVYVHKDARGHGIGKRLXQAL
1yk3A1          NAQLEGTYSLPL--IGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAIADLSKVNRGFGPLLLPRI
2fl4A1          QQAFIESMAENLKESDQFPEWES-AGIYDGNQLIGYAMYGRWQDGRVWLDFLIDQRFQGQGYGKAACRLL
1u6mA           VYEHAGEVAGAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDISVDERFRGMGIGSKLLDAL
2ae6A1          ------------------------FVAISGQQLAGPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYI
2fsrA1          GGPYDLPFCHDLANWHFFGHGALXIDLGETGECIGQIGNHGPLFPEKELGWLLYEGHEGRGYAAEAAVAL
1lrzA3          ------------------------VPLAYINELPISAGFFFINPFEVVYYGGTSNAFRHFAGSYAVQWEM
1y9kA1          ---------------------GLTYVAKQGGSVIGVYVLLETRPKTXEIXIAVAEHLQGKGIGKKLLRHA
1cm0A           PRMPKEYITRLVFDPKHK-----TLALIKDGRVIGGICFRMFPSQGFEIVCAVTSNEQVKGYGTHLMNHL
1mk4A           GGRQLKE---KLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYSGVHPDFRKMQIGKQLYDVF
1xmtA           ------------------------RFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLAS----HL
2a6aA2          ------------------------------------------RKGYHYCAYLKDKGLNPLKEPSVVSDEE
1nslA           ------------------------AGLLYDGSLCGXISLLDQVNRKAEIGYWIAKEFEGKGIITAACRKL
2fckA1          ---------------NWVKAEAYGFGVFERQTTLVGXVAINEFYHTFSLGYWIGDRYQRQGYGKEALTAL
1z4eA1          RERYEKPLPVSYVRAEIKKDKNNELIVACNGEEIVGMLQVTQGSWRATIEVRTHSAARGQGIGSQLVCWA
1bobA           --------------------------------TTYKYWHYIDKKFRAKISFLIFPPYQNKGHGSCLYEAI
2ge3A1          ---------------------HPQFVAIADGDVIGWCDRRQDRATRAHCGTGILPAYRNKGLGARLXRRT
1vhsA           RXEWFSGHTESRPLYVAEDENGAAWISFETFYGRPA------YNKTAEVSIYIDEACRGKGVGSYLLQEA
2bswA1          ------------------------LGGYYGGKLISIASSELQGQKQYQLRXATLEGYREQKAGSSLIKHA
1i12A           ------------------------IVDKRTETVAATGNIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQL
1yreA1          ------------------------PLAVRLGVQLVGTTRFAEFLPALPAWTWLDQAQHGSGLNRMIKYLM
1ro5A           LIQEDGQVFGCWRILDTTG----PYMLKNTFPELLHGKEAPCSPHIWELSFAINSGQKGSLGFSDCTLEA
1on0A           ------------------------WSLKLNEKDIVGWLWIHAEPEHPQQEFGLYEPYRGKGYALAALDQA
2ozgA2          VXSFGDSEIYVKGIGLEN-----FRVIYREQKVAGGLAILPXGQWWGGQRVGIAPEYRGDGAAIALIQHT
1wwzA1          ------------------------FVAKVGDKIVGFIVCDKDWFIVGAIHFVVDKKFQGKGIGRKLLITC
2fiaA1          AYMDVVGITQWTKDYPSQGDIKRLYLLVHEEMIFSMATFCMEQEQVWLKRFATSPNYIAKGYGSLLFHEL
1tiqA           ------------------------FFIYFDHEIAGYVKSEEXGAESLEIEIYIKNSFQKHGLGKHLLNKA
1s3zA           PGHPDDAHLADGEEILQADHLAS-FIAMADGVAIGFADGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAV
2hv2A2          NQEPTAER---QERFEKLLSHTQSYGFLIDEQLTSQVNFHGVRYPXAGIGVASYPEYRGEGGI-SAIXKE


                         .         .         .         +         .         .         .:280
query           IITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYEIxx
1yr0A1          IDHAGGNVLIAAIEAENTASIRLHESLGFR------------
1yk3A1          VASVFANRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNR--
2fl4A1          MLKLIEKYQTNKLYLSVSSAIRLYQQLGFVFNGELDTNGE--
1u6mA           PEVAKASALGLNVDFDNPGARKLYASKGFKDVTTMTISGH--
2ae6A1          KDXAEISGIHKLSXATNQEAIRFYEKHGF-------------
2fsrA1          RDWAFETTLVSYVSPQNRKSAAVAERIGGT------------
1lrzA3          INYALNHSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDF----
1y9kA1          VETAKGYKLEVGTGNSSVSQLALYQKCGFR------------
1cm0A           KEYHIKHDILNFLTYADEYAIGYFKKQGFS------------
1mk4A           IETVKQRRVKCVTSPVNKVSIAYHTKLGFD------------
1xmtA           CVAAFEHSIIPSFLPRNPSWKPLIHSEVF-------------
2a6aA2          LEEITKEKIVLKDDLLISPAVLVEESERLF------------
1nslA           ITYAFEERVAICAAVGNEKSRAVPERIGFLEEGKARDG----
2fckA1          ILFCFERRLEIVCDPENVPSQALALRCGANR-----------
1z4eA1          IERAKERLIQLTTDKQRPDALRFYEQLGFK------------
1bobA           IQSWLEDITEITVEDPNEAFDDLRDRNDIQ------------
2ge3A1          LDAAHEFRIELSVHADNARAIALYEKIGFA------------
1vhsA           LRIAPNLSLXAFIFGHNKPSLKLFEKHGFA------------
2bswA1          EEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDT----
1i12A           VTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQI----
1yreA1          LKHAFDNRVQLSTAASNLRAQGAIDKLGAQ------------
1ro5A           MRALARYDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHL----
1on0A           ARSXGIRKLSLHVFAHNQTARKLYEQTGFQVXSKKL------
2ozgA2          LQEISEQDI--PISVLYPATQRLYRKAGYEQAGSSCVW----
1wwzA1          LDFLGKYTIELWVGEKNYGAMNLYEKFGFK------------
2fiaA1          EKRAVWEKMYAQTNHTNHRMIRFFESKGFT------------
1tiqA           IEIALERNIWLGVWEKNENAIAFYKKXGFV------------
1s3zA           QRWGTNKEMASDTSPENTISQKVHQALGFEETERVIFY----
2hv2A2          XLADLAKQKVALSYLAPF-SYPFYRQYGYEQTFEQAEY----