[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99739.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1k6wA2.bssp"
#ERROR : Can't open dsspfile "2gokA1.bssp"
#ERROR : Can't open dsspfile "2p9bA2.bssp"
#ERROR : Can't open dsspfile "1yixA1.bssp"
#ERROR : Can't open dsspfile "1xwyA1.bssp"
#ERROR : Can't open dsspfile "3be7A1.bssp"
#ERROR : Can't open dsspfile "1un7A2.bssp"
#ERROR : Can't open dsspfile "1k6wA1.bssp"
#ERROR : Can't open dsspfile "1a4lA.bssp"
#ERROR : Can't open dsspfile "2ftyA2.bssp"
#ERROR : Can't open dsspfile "2pajA2.bssp"
#ERROR : Can't open dsspfile "1xrfA1.bssp"
#ERROR : Can't open dsspfile "1a5kC1.bssp"
#ERROR : Can't open dsspfile "2a3lA1.bssp"
#ERROR : Can't open dsspfile "1gkpA1.bssp"
#ERROR : Can't open dsspfile "1zzmA1.bssp"
#ERROR : Can't open dsspfile "2i9uA1.bssp"
#ERROR : Can't open dsspfile "2r8cA1.bssp"
#ERROR : Can't open dsspfile "1ymyA2.bssp"
#ERROR : Can't open dsspfile "1ymyA1.bssp"
#ERROR : Can't open dsspfile "2oodA1.bssp"
#ERROR : Can't open dsspfile "1onwA1.bssp"
#ERROR : Can't open dsspfile "2ftyA1.bssp"
#ERROR : Can't open dsspfile "1m7jA1.bssp"
#ERROR : Can't open dsspfile "1j6pA1.bssp"
#ERROR : Can't open dsspfile "2bb0A1.bssp"
#ERROR : Can't open dsspfile "1un7A1.bssp"
#ERROR : Can't open dsspfile "2p9bA1.bssp"
#ERROR : Can't open dsspfile "1gkrA1.bssp"
#ERROR : Can't open dsspfile "2oofA1.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"
#ERROR : Can't open dsspfile "1m7jA3.bssp"
#ERROR : Can't open dsspfile "2i9uA2.bssp"
#ERROR : Can't open dsspfile "2dvtA1.bssp"
#ERROR : Can't open dsspfile "3be7A2.bssp"
#ERROR : Can't open dsspfile "1o12A2.bssp"
#ERROR : Can't open dsspfile "1gkpA2.bssp"
#ERROR : Can't open dsspfile "2icsA1.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"

## Summary of PDB Search
:578
    7e-21  14%  1k6wA2 [c.1.9.5] CYTOSINE DEAMINASE A:56 -- 375
    3e-18  14%  2gokA1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:17 -- 79 A:381 -- 420
    5e-18  15%  2p9bA2 [c.1.9.17] POSSIBLE PROLIDASE A:71 -- 394
    5e-17  14%  1yixA1 [c.1.9.12] DEOXYRIBONUCLEASE YCFH A:1 -- 265
    3e-16  14%  1xwyA1 [c.1.9.12] DEOXYRIBONUCLEASE TATD A:1 -- 260
    1e-15  15%  3be7A1 [b.92.1.9] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE A:3 -- 56
    5e-15  15%  1un7A2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:58
    2e-14  14%  1k6wA1 [b.92.1.2] CYTOSINE DEAMINASE A:4 -- 55 A:376 -- 426
    3e-14  12%  1a4lA  [c.1.9.1] ADENOSINE DEAMINASE
    5e-14  20%  2ftyA2 [c.1.9.6] DIHYDROPYRIMIDINASE A:57 -- 440
    8e-14  12%  2pajA2 [c.1.9.9] PUTATIVE CYTOSINE/GUANINE DEAMINASE A:70 -- 405
    8e-14  17%  1xrfA1 [b.92.1.3] DIHYDROOROTASE A:1 -- 55 A:366 -- 422
    1e-13  29%  1a5kC1 [b.92.1.1] UREASE (ALPHA SUBUNIT) C:2 -- 129 C:423 -- 475
    6e-13   8%  2a3lA1 [c.1.9.1] AMP DEAMINASE A:212 -- 839
    4e-12  22%  1gkpA1 [b.92.1.3] HYDANTOINASE A:2 -- 54 A:390 -- 459
    3e-11  12%  1zzmA1 [c.1.9.12] PUTATIVE DEOXYRIBONUCLEASE YJJV A:1 -- 259
    7e-11  16%  2i9uA1 [b.92.1.4] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:9 --
    7e-11  17%  2r8cA1 [b.92.1.9] PUTATIVE AMIDOHYDROLASE A:2 -- 57 A:369 -- 414
    8e-11  16%  1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:54
    3e-10  12%  1ymyA1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:1
    1e-09  17%  2oodA1 [b.92.1.4] BLR3880 PROTEIN A:3 -- 72 A:398 -- 467
    1e-09   9%  1onwA1 [b.92.1.7] ISOASPARTYL DIPEPTIDASE A:1 -- 62 A:347 -- 389
    3e-09  17%  2ftyA1 [b.92.1.3] DIHYDROPYRIMIDINASE A:2 -- 56 A:441 -- 541
    6e-09  23%  1m7jA1 [b.92.1.6] D-AMINOACYLASE A:7 -- 61
    1e-08  16%  1j6pA1 [b.92.1.4] METAL-DEPENDENT HYDROLASE OF A:-1 -- 49 A:331 --
    1e-08  18%  2bb0A1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:3 -- 73 A:374 -- 415
    1e-08  22%  1un7A1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:3
    2e-08  23%  2p9bA1 [b.92.1.10] POSSIBLE PROLIDASE A:9 -- 70 A:395 -- 450
    2e-08  26%  1gkrA1 [b.92.1.3] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE A:1
    3e-08  16%  2oofA1 [b.92.1.10] 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE A:3 --
    6e-08  12%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412
    7e-08  12%  1m7jA3 [c.1.9.11] D-AMINOACYLASE A:62 -- 419
    1e-06  12%  2i9uA2 [c.1.9.9] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:67 --
    3e-06   9%  2dvtA1 [c.1.9.15] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE A:1 --
    4e-06  22%  3be7A2 [c.1.9.18] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE A:57 --
    1e-05  19%  1o12A2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:44
    3e-05  21%  1gkpA2 [c.1.9.6] HYDANTOINASE A:55 -- 389
    2e-04  21%  2icsA1 [b.92.1.8] ADENINE DEAMINASE A:4 -- 54 A:322 -- 371
    4e-04  12%  1dpmA  [c.1.9.3] PHOSPHOTRIESTERASE
    6e-04  10%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
:578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
1k6wA2          --------------------------------------------------------------WNQSGTLF
2gokA1          ------------------ATALWRNAQLATLNPAMVENAVIAVRNGRIAFAGDLSTADETTDCGGRWITL
2p9bA2          ---------------------------------------------------------------------P
1yixA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
3be7A1          ------------------EDFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
1un7A2          ----------------------------------------------------------------------
1k6wA1          --------------------QTIINARLPGEEGL----WQIHLQDGKISAIDAQSGVMPITDAEQGLVIP
1a4lA           ---------------------PAFNKPKVELLDGAIKPETILYFGKKRGIALPAEELRNIIGMDKPLSLP
2ftyA2          ----------------------------------------------------------------------
2pajA2          ---------------------------------------------------------------------P
1xrfA1          ------------------LKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDILVPEAEIIDAKGLIVCP
1a5kC1          -------------LAADCVDLVLTNALIVDH--WGIVKADIGVKDGRIFAIGKAGNATEVIAAEGKIVTA
2a3lA1          ----------------------------------------------------------------------
1gkpA1          --------------------LLIKNGEIITA--DSRYKADIYAEGETITRIGQNPPGTEVIDATGKYVFP
1zzmA1          ---------------------------------------------------------------------C
2i9uA1          ----------------------------------------------------------------------
2r8cA1          --------------------FLFRNGALLDPDHPDLLQFEILIEDGFIREVSDKSSNAHVIDVKGKTIMP
1ymyA2          ----------------------------------------------------------------------
1ymyA1          --------------------YALTQGRIFTGHEF-LDDHAVVIADGLIKSVCPVPPEIEQRSLNGAILSP
2oodA1          ----------------------------------------------------------------------
1onwA1          -----------MIDYTAAGFTLLQGAHLYAP--EDRGICDVLVANGKIIAVASNVPNCTVVDLSGQILCP
2ftyA1          ------------------YDLIIKNGIICT--ASDIYAAEIAVNNGKVQLIALGSEVIDAEGAFITPILP
1m7jA1          ------------------FDYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGSASSARRRIDVAGKVVSP
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          -------------------DVIVKNCRLVSS--DGITEADILVKDGKVAAISADVEASRTIDAGGKFVMP
2oofA1          ----------------------------------------------------------------------
2qs8A1          ------------------SKTLIHAGKLIDGKSDQVQRISIVIDGNIISDIKKGFISSNDFELRDHTVLP
1m7jA3          ----------------------------------------------------------------------
2i9uA2          ---------------------------------------------------------------------P
2dvtA1          ---------------------------------------------------------------------Q
3be7A2          ----------------------------------------------------------------------
1o12A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1dpmA           ---------------------------------------------------------------PITISEA
1wz8A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
1k6wA2          EGIERWAERDDVKQRAWQTLKWQIANGIQHVRTHVD--VSDATLTALKAMLEVKQEVAPWIDLQIVAFPQ
2gokA1          EAGKSADFAIWDIERPAELVYRIGFNPLHARIFKGQKV--------------------------------
2p9bA2          GLINAHTHLFSYXAATVKHNATTLLESGVTTIRTLGDVGYEV--VTLRDQIDAGQILGPRILASGPHGAP
1yixA1          -LVDSHCHLDGLDYESLH-------KDVDDVLAKAFCLAVATTLPSYLHMRDLVGERD-NVVFSCGVHPL
1xwyA1          --FDIGVNLTSSQFAKDDVVACAFDAGVNGLLITGTNLRESQQAQKL-----ARQYSSCWSTAGVHPHDS
3be7A1          QIKEGFDADIVGVIENPLA-NIRTLEEVAFVMKEGK----------------------------------
1un7A2          GMIDIHIHGDASFSTLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKAAEELGIHLEGPFVSP
1k6wA1          LIILPAENGFDALRRQVPV-RYSVRGGKVIASTQPAQTTVYLEQPEA-----------------------
1a4lA           GFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQE
2ftyA2          GGIDAHVHVDEPLKLLGDATRSAVAGGTTTVVAFSTQDVSKALAESVKLDVDEYSEQTLYCDYGLHLILF
2pajA2          AWVNTHHHLRRFRLAARIGLIELARSGCATVADHNYVYYPGMPFDSSAILFEEAEKLGLRFVLLRGGATQ
1xrfA1          TLKLGSPADITIFDPNKEWETNLSKSRNTPLWGKV-----------------------------------
1a5kC1          GSIEVGKLADLVVWSPAFFPATVIKGGMIAIA-PMGDINASIPTPQPVHY--------------------
2a3lA1          -----NDLYSENVVWLIQLPRLYNIYKDMGIVTSFQNILDNIFIPLFEATVDPDSHPQLHVFLKQVVGFD
1gkpA1          GADLVVYDPQYRGTISVKTFEGFEIDGRPSVVTVRGKVAVRDGQF-------------------------
1zzmA1          RFIDTHCHFDFPPFSGEASLQRAAQAGVGKIIVPA---TEAENFARVLALAENYQPLYAALGLHPGMLEK
2i9uA1          ----------------------------------------------------------------------
2r8cA1          RIVPAHADVLVVDGNPLKSCLLGQGEHIPLVMKDGR----------------------------------
1ymyA2          GFIDVQLNGAVSVETLEIMQKANEKSGCTNYLPTLIDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNL
1ymyA1          TLAAGKVANLTAFTPDFKITKTIVN-GNEV----------------------------------------
2oodA1          ----------------------------------------------------------------------
1onwA1          EILPGNDADLLVMTPELRIEQVYARGKLMVK---------------------------------------
2ftyA1          GVSDADLVIWYPDDSKKEPKLITNKLMEHNCDYTPFEGIEIKN--WPRYTIVKGKIVYKEGEILKEN---
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          TLQVGSDA--------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          SIESGKLA-DLIAVKGNPIEDISVLENVDVVIKD------------------------------------
1m7jA3          ----------------------------------------------------------------------
2i9uA2          GMNDLHAHAQYKNLGIGMDKELWLNNYTFPKFLNVDYAKKTY----GRLIKDLIKNGTTRVALFATLYVG
2dvtA1          GKVALEEHFAIPGFVPGDYWKELQHAHGIETMILSLNAPAVQAIPDRRKAIEIARRANDVLAEEPDRFLA
3be7A2          GLMDSHVHIVGNDSKGEESSHMGTVWGVKTLMAGFTTVRNVGAANYADVSVRDAIERGCDHN-LLPPEFN
1o12A2          ----------------------------------------------------------------------
1gkpA2          -FIDPHVHIYLPFMTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGN-------SYCDYT
2icsA1          ----------------------------------------------------------------------
1dpmA           GFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLARAAGVRTIVDVSTRAADVHIVAATGLWFDPP
1wz8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
1k6wA2          EGILSYPNGEAL---LEEALRLG-ADVVGAIPHFEFTREYGVESLHKTFLAQKYDRLIDVHCDEIDDERV
2gokA1          ----------------------------------------------------------------------
2p9bA2          LIALTSGTPEEARTAVAQNLKAGKIAATGGVTDAQEIQXSVEQXRAICDEAHQYGVIVGAHAQSPEGVRR
1yixA1          NQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTL
1xwyA1          SQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLRIAADLNMPVFMHCRFMTLLEP
3be7A1          ----------------------------------------------------------------------
1un7A2          KRAGAQPKEWIRPSDVEEDQHFELIRHLKDIIASMGHTDADSALLSDAAMTHLYNAMSPFHHREPGTALA
1k6wA1          ----------------------------------------------------------------------
1a4lA           GEQAFGIKVRSILCCMRHQPSWSLVVAMDLAGDETIEGSSLFPGHVEAYGAVKNGIHRTVHAGEVGSEAV
2ftyA2          QIEKPSEARELLDVQLQAAYNDYGVSSVXMFMTYPGLQISDYDIMSAMYATRKNGFTTMLHAGDMVKWMI
2pajA2          TRQLEAETLDAYVADIERLAARYRAMRRVVMAPTTVLYSISPREMRETAVARRLGLRMHSHLPVAFCGEH
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          LVDDESKPRPTKHMPTPAQWTNAFNPAFSYYVYY---CYANLYVLNKLRSKGMTTITLRPHSGEAGDIDH
1gkpA1          ----------------------------------------------------------------------
1zzmA1          HSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLA
2i9uA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1ymyA2          VPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLKEAKAGFRAGITFATHLYNAMPYITGREP
1ymyA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1m7jA3          -------------------------LKQDRVLLAGRTLITWCKPYPELSG------RDLEEIAAERGKSK
2i9uA2          KVNMDYNCPDYLTENYITSLNDTKSNIVKPIITPRFVPSCSNELMDGLGLSYKYRLPVQSHLLDEIAVVK
2dvtA1          FAALPLQDPDAATEELQRCVNDLGFVGALVNGDGQTPLYYDLPQYRPFWEVEKLDVPFYLHPLPQDSRIY
3be7A2          Y------SSEGVVDSPWDLIKFCATGGVMSRNTDVNAKQFTLEEMKAIVDAHNHGMKVAAHAHGLIG--I
1o12A2          ----------------------------------------------------------------------
1gkpA2          FHMAVSKFDEKTEGQLREIVADGIS-SFXIFLSYKNFFGVDDGEMYQTLLAKELGVIV------------
2icsA1          ----------------------------------------------------------------------
1dpmA           LSMRLRSLTQFFLREIQYGIETGIRAGIIKVATTGKATPFQELVLKAAAASLATGVPVTTH---------
1wz8A1          ------------EARYPGLAFAWPRPGVLEITFRGEKLNAPPALHRGLARV-------------------


                         .         .         .         +         .         .         .:280
query           NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
1k6wA2          TASHTTAMHSYNGAYTSRLFRLLKMSGIIHLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYP
2gokA1          ----------------------------------------------------------------------
2p9bA2          SLLAGVDTIEHGSVLDDELIGXFRHNPNALPLTLLGQDVTGITDIQLENSKNVVGGXVSGARQAHEAGLX
1yixA1          AILREEKVVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDPHRGKENQP
1xwyA1          WLDKLPGAVLHCFTGTREEMQACVAHGIYIGITGWVCDEELRELLPLIPLIETDAPYLLPRDLTPKPSSR
3be7A1          ----------------------------------------------------------------------
1un7A2          HDGFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSM-RAKGLKDGVYEFGGQSVTVRGRTALLSDSI
1k6wA1          ----------------------------------------------------------------------
1a4lA           DILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAV-VRFKNDKANYSLNTLIF
2ftyA2          EALEEQGLAYYHGVSRPSIVEGEATNRAITLATT----MDTPILFVHVSSPQAKQAQTKGLKVYAETCPQ
2pajA2          DWLGSDVWYAHLVKVDADEIALLAQTGTGVAHCPQSGRLPVREMADAVPVSIGVDGAASNEAADMISEVH
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          LAATFLTCHHGINLRKSPVLQYLYYLQIGLAMSPLSNNSLFLDYHPFPVFFLRGLNVSLSTDDPLQIHLT
1gkpA1          ----------------------------------------------------------------------
1zzmA1          MHLKRHDLPRTGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAFQGQPNRP
2i9uA1          ------------------------------------------------------------NLIFTKTSDK
2r8cA1          ----------------------------------------------------------------------
1ymyA2          GLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLS
1ymyA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1m7jA3          YDVVPELQPAGAIYFMMDEPDVQRILAFGPTMIGSDGLPHDERPHPRLWGTFPRVLGH------------
2i9uA2          SLHKKSNFYGEVYDKFGLFGNTPTLMAHCIHFNLGSGMMPVRKYL-----NLGINVVLGSDI----SAGH
2dvtA1          DGHPWLLGPTWAFAQETAVHALRLMASEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLPPRYPAKRRFM
3be7A2          KAAIKAGKNNTVLSMDIFVSDYILGEGAKAGIREESL--NKERLVGKKQRENFMNAHRRGAIITFGTIFD
1o12A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
1k6wA2          LVLHMGLHVCQLMGYGQINDGLNLITHHSARTLNL-QDYGIAAGNSAN----------------------
2gokA1          ----------------------------------------------------------------------
2p9bA2          YATWRELELLVAYAGFSPAEALHAATAVNASILGVDAE--------------------------------
1yixA1          AMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASQSI-----------------------------
1xwyA1          RNEPHILQRIAHWRGEDAAWLAATTDANVKTLFGIA----------------------------------
3be7A1          ----------------------------------------------------------------------
1un7A2          LKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDR--------------------------------
1k6wA1          ----------------------------------------------------------------------
1a4lA           KSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFL-----------------------------------
2ftyA2          YALLSDAITRCHGVG-------------------------------------------------------
2pajA2          MTWL-----AQRARLASIAEVIHWGTAGGARVMGLDEVG-------------------------------
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          KEPLVEEYSIAASVWKLSACDLCEIARNSVYQSGFSHAKSHWIGKDYYKRGPD-----------------
1gkpA1          ----------------------------------------------------------------------
1zzmA1          EQAARVFAVLCELRREPADEIAQALLNNTYTLFNV-----------------------------------
2i9uA1          FTIMKDSYIVVIDGKIASVSSNLPDKYKGNPIIDFRNNIIFEEGYDFDALVIN--DSNLYPEDYDLTERL
2r8cA1          ----------------------------------------------------------------------
1ymyA2          SLTMIEGVRNLVEHGIALDEVLRMATLYPARAIGVEKR--------------------------------
1ymyA1          ----------------------------------------------------------------------
2oodA1          --------------KAFGPYEKIAAAHPGVEITHIKDRIVFEPGKEADFVALD--PNGGQLAQPWHQSLI
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          -DFSSEPFWGAVEIEGTIKRVLQGEVKVDLDLSGKLVXPKIEEGWNADLVVI------------------
2bb0A1          --------GIHEQKIVFAGQKGAEAGYEADEIIDCSGRVTLKAGRSADLVIWYHYGVNHVHQVMKNGTIV
1un7A1          -------------STERPKEPYSKEIQAPADSVL---LPSVTVGKDADLVIVS--SDCEVILTICRGN--
2p9bA1          -------------DGRIEQVAPSIETSIPAEYHYLGKIVXLEVGKSADLLVLNPLDDLRPALVIAAGHPV
1gkrA1          ----------------------------------------------------------------------
2oofA1          --GLLEPHALGVHEGRIHALVPXQDLKYPAHWQDXKGKVTLRVGXLADFLVWYLIGVDQLVSRVVNGEE-
2qs8A1          ----------------------------------------------------------------------
1m7jA3          --------YSRDLGLFPLETAVWKMTGLTAAKFGLAERG-------------------------------
2i9uA2          TCSLFKVIAYANSKIKWQESGKKDMFLSTSEAFYM-----------------------------------
2dvtA1          DYFNEN-FHITTSGNFRTQTLIDAILEIGADRILFSDWPFENIDHASDWFNAIAEADRV-----------
3be7A2          HGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIG-------------------------------
1o12A2          ---FSQAVKNFRKFGCSITELAKVSSYNSCVELGLDDRG-------------------------------
1gkpA2          ----------VSRGRLDIHRFVDAASTKAAKLFGLFPRGTIAVGS-------------------------
2icsA1          ------------------------ISGSAKETIHLEPGATLEIGKDADLTIF------------------
1dpmA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SQGNEYLGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1k6wA2          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2p9bA2          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1un7A2          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
2ftyA2          ----------------------------------------------------------------------
2pajA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
1zzmA1          ----------------------------------------------------------------------
2i9uA1          E---------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oodA1          GAGPRT----------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          WRPGPKRFA-------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1m7jA3          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2dvtA1          ----------------------------------------------------------------------
3be7A2          ----------------------------------------------------------------------
1o12A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1k6wA2          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2p9bA2          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1un7A2          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
2ftyA2          ----------------------------------------------------------------------
2pajA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
1zzmA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1m7jA3          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2dvtA1          ----------------------------------------------------------------------
3be7A2          ----------------------------------------------------------------------
1o12A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1k6wA2          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2p9bA2          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1un7A2          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
2ftyA2          ----------------------------------------------------------------------
2pajA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
1zzmA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1m7jA3          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2dvtA1          ----------------------------------------------------------------------
3be7A2          ----------------------------------------------------------------------
1o12A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxx
1k6wA2          ------------------
2gokA1          ------------------
2p9bA2          ------------------
1yixA1          ------------------
1xwyA1          ------------------
3be7A1          ------------------
1un7A2          ------------------
1k6wA1          ------------------
1a4lA           ------------------
2ftyA2          ------------------
2pajA2          ------------------
1xrfA1          ------------------
1a5kC1          ------------------
2a3lA1          ------------------
1gkpA1          ------------------
1zzmA1          ------------------
2i9uA1          ------------------
2r8cA1          ------------------
1ymyA2          ------------------
1ymyA1          ------------------
2oodA1          ------------------
1onwA1          ------------------
2ftyA1          ------------------
1m7jA1          ------------------
1j6pA1          ------------------
2bb0A1          ------------------
1un7A1          ------------------
2p9bA1          ------------------
1gkrA1          ------------------
2oofA1          ------------------
2qs8A1          ------------------
1m7jA3          ------------------
2i9uA2          ------------------
2dvtA1          ------------------
3be7A2          ------------------
1o12A2          ------------------
1gkpA2          ------------------
2icsA1          ------------------
1dpmA           ------------------
1wz8A1          ------------------