[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99766.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs6R1.bssp"

## Summary of PDB Search
:102
    2e-26  40%  1vs6R1 [b.155.1.1] 50S RIBOSOMAL PROTEIN L21 R:1 -- 103
:102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
1vs6R1          MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMIAGEEVKIGVPFVDGGVIKAEVVAHGRGEK


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXHQHTKQGHRQPYTKVVIDAINA
1vs6R1          VKIVKFRRRKHYRKQQGHRQWFTDVKITGISA