[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99824.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2basA1.bssp"

## Summary of PDB Search
:248
    7e-20  19%  2basA1 [c.1.33.1] YKUI PROTEIN A:2 -- 262
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLE
2basA1          --------IDDVLPYYQAIFSA---EEQKVVGYEVLGRADSEIQSLGPFFLDAGIPEEYKLEVDNRI---


                         .         .         *         .         .         .         .:140
query           IKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGY
2basA1          IRQALADSDLLIFXNQDANLLXLDHGESFLELLKEYEARFVLEITEHNFEG-DIEQ-LYHXLAYYRTYGI


                         +         .         .         .         .         *         .:210
query           RVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDD
2basA1          KIAVDNIGKESSNLDRIALL--SPDLLKIDLQALKSPSYEH-----VLYSISLLARKIGAALLYEDIEAN


                         .         .         .         +         .         .         .:280
query           VAAKEMLCHNIKLQQGFFWQVPQDYISPKEVxxxxxxx
2basA1          FQLQYAWRNGGRYFQGYYLVSPSETFLERDV-------