[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99837.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"

## Summary of PDB Search
:586
    4e-37  30%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    2e-35  21%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    6e-34  35%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    8e-34  26%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-33  18%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-31  22%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-30  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-30  13%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-25  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    7e-25  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    8e-25  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-24   7%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-24  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    3e-24  16%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-23  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    1e-23  10%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    3e-23   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    6e-23  13%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    2e-22  11%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-22  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    3e-22  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    7e-22  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-21  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    7e-21  10%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    1e-20  12%  1jbkA  [c.37.1.20] CLPB PROTEIN
    1e-20  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    1e-20   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-20  16%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-19  14%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-19   8%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    4e-19  12%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    4e-19  14%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    5e-19  10%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    3e-18  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-17  12%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-17  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    1e-17   9%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-17   5%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-17  16%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    3e-17   8%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    3e-17  14%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    4e-17  23%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-17  14%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    4e-17  12%  1jb1A  [c.91.1.2] HPRK PROTEIN
    6e-17  12%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-16  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    1e-16   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-16  17%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-16  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    1e-16  14%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-16   8%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    1e-16  10%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-16  13%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    2e-16  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    3e-16   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    6e-16  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    8e-16  12%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    9e-16   8%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    1e-15  19%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-15  10%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    4e-15   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    4e-15  11%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    4e-15   7%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    4e-15   9%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    5e-15   9%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-14  14%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    1e-14  34%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-14  11%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-14  13%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    2e-14  13%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    5e-14  11%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    7e-14  10%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    7e-14  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    1e-13  10%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    1e-13  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    1e-13  17%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    2e-13  16%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    2e-13   9%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    2e-13  22%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-13  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    5e-13  19%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    5e-13   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    6e-13  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    8e-13  17%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    8e-13  12%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    1e-12  22%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-12  11%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-12  15%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-12  10%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-12   8%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    4e-12  12%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-11  10%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-11  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    4e-11  13%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    1e-10  13%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    2e-10  15%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    2e-10   8%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-10  13%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    4e-10  14%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    7e-10  14%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    8e-10   9%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-09  12%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-09   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-09  23%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323
    2e-09  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-09  12%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320
    2e-09  20%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-09  11%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-09  11%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    4e-09   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    7e-09  11%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    8e-09   9%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    1e-08  13%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    1e-08  10%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    2e-08  16%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-08  10%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-08  11%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    6e-08   8%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    1e-07  18%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-07  10%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-07  11%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    3e-07  23%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    4e-07  11%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    7e-07  15%  1g31A  [b.35.1.1] GP31
    2e-06  15%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    2e-06  14%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    2e-05  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    6e-05  16%  1oa8A  [b.145.1.1] ATAXIN-1
    7e-05  11%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    9e-05  31%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    9e-05  12%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-04  13%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    3e-04  10%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    3e-04  40%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    4e-04  19%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    4e-04  13%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
:586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxWVKPFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRPENILLVYVPI
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2hydA2          ------------------QFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIALTTDEKVHHLTIAIGI
1q3tA           ----------------------------------------------------------------------
1pf4A2          ---------------RLWTYIRLYKAGLVVSTIALVINAAADTYMISLLKPLLDEGFGNAESNFLRILPF
1w1wA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSEDINHIQNL
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2hydA2          ALF-IFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDF
1q3tA           ----------------------------------------------------------------------
1pf4A2          MIL-GLMFVRGLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGA
1w1wA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLRTIFPTFVAWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1pf4A2          TSRALVSIVREG----------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGS
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhdA1          ---------------------------------KTLKDARDKIVSDLIQQFNQMIITGNEFQTGGIGNLP
1l7lA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ---------------------------------------------FFMQDNDFTLFGAESSLKYDAASRQ
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGVYTGLANWIAAFVLCLFPVVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKL
1b0uA           -------------------------------------------------------------------LHV
1sgwA           -------------------------------------------------------------------LEI
1pf4A1          -----------------------------------------------------ETERDNGKYEAEGEVDV
1q3hA           -------------------------------------------------------------------EKV
1e69A           -------------------------------------------------------------------MRL
1l7vC           ----------------------------------------------------------------------
1ji0A           -------------------------------------------------------------------LEV
1m3eA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1e9rA           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVS--GGKL
1poiA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1c4oA1          -------------------------------------------------------------------FRY
1nijA1          ----------------------------------------------------------------------
1qhlA           -------------------------------------------------------------------GKF
2gk3A1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mjgM           ------------------------------------------------------------------TRGI
2iqhA1          ----------IDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDYRRVDGKWRRELILYDKEEI
1bmfA3          ------------------------------------------------KGPIGSKARRRVGLKAPGIIPR
1ex6A           ----------------------------------------------------------------------
1pv4A3          -------------------------------------------------------------------ILF
1kgdA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------DLTERA
2axpA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g6oA           ---------------------------------------------------------------------E
1bgxT2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1vplA           -------------------------------------------------------------------VVV
1yvuA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhdA1          IRNWNFDFGLLGTTLLNLDANYVETARN-------TIDYFVDFVDNVCMDEMVREQRNGIAPQSDSLIKL
1l7lA           ----------------------------------------------------------------------
1urjA           -------------------------------------------------------------------TTG
1bs2A1          ----------------------------------------------------------------------
1g8yA           -------------------------------------------------------------------HKP
1tljA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ckvA           ---------------------------------------------------------------VNSNAYD
3cddA2          -------------------------------------------------------------------LKA
1lw7A2          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1cd5A           -----------------------------------------------------------VEMHKAGQVSF
1s9hA           ---------------------ISFNAASNSRSQIKAALDNAMSLTKTAPDYLVGQQPVEDISSNRIYKIL
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           IEIYPIAGTRPRGRRADGTLDRDLDSRIELDMRTDHKELSEHLMLVDLARNDLARICTPGSRYVAKVDRY
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          -------------------------------------------------------------------LEA
1e3mA2          -------------------------------------------------------------------IRI
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1g6hA           -------------------------------------------------------------------LRT
1esmA           -----------------------------AALRDSVPXTLSEDEIARLKGINEDLSLEEVAEIYLPLSRL
2fggA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           -------------------------------------------------------------------IPD
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1ovmA2          -------------------------------------------------------------------IDS
1np6A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          -------------------------------------------------------------------TIT
1yj5A2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2vnuD1          -----------------------------------------YVGQLAPSSVDPQSSSTQNVFVILXDIRT
1mi8A           -------------------------------------------------------------------VSI
2hydA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1tueA           ---------------------------------------------FRCSKIDEGGDWRPIVQF----LRY
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1pgsA2          -----------------------------------------------------------VPVIQYNKSSI
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1xzpA1          ------------------------------------------------------EIRVELDYPDEIETNT
1tpzA           ----------------------------------------------------FKKFNTGRKIISQEILNL
1dwmA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
1b0uA           IDLHKRY--GGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKD
1sgwA           RDLSVGYD---KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKI
1pf4A1          KDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKTNL
1q3hA           SFSHLCL--VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFSQFSWI
1e69A           KKLYLK----GFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGAYV
1l7vC           ---------AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQFAGQPLEAWATKL
1ji0A           QSLHVYY--GAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHV
1m3eA1          --------------AVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGLGL
1mukA           -MRARRHSYSSFSKLLEAYLLVK-----WRMCEAREPSVDLRPLCAGIDP-LNSDPFLKMVSVGPMLQST
1e9rA           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1poiA           --------------KDAIAKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGLGGAAGGDWDMLIVKA
1khbA1          ---------AEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGH
1c4oA1          RGPSPKG--DQPKAIAGLVEALRDGERVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEF
1nijA1          ----------------------NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDQLI
1qhlA           RSLTLIN----WNGFFARTFDLDEL-VTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCYSML
2gk3A1          ----------------------------------------------------------------------
2yyeA2          --------------------GAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARNL
1jalA1          ------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRDAL
1mjgM           KLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVIGPDIDQIPEGS
2iqhA1          RRIWRQANNGDHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMEL
1bmfA3          ISVREPM--QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIG
1ex6A           ---------------------------IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGVNG
1pv4A3          ENLTPLHANSRLRXVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEV
1kgdA           ------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKY
1jbkA           EQGKLDPVIGRDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGA
2axpA1          ---------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKNK
1t06A           --------------VMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELY-ATG
1jjvA           ------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLL
1rkbA           ---------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLKY--INVGDLAREQLYDGY
2v3jA1          ------------QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLN-CDDHQGLLKKXGRDISEARPDI
1jqjA2          ----------------------------------------------------------------------
1ohcA1          ---------------------------------------------------PQDDVYLDITDRLCFAILP
2gx8A1          ----------------------------GAGHIGNYSHCTFSSEGTGTFVPQQLTIIPASLQRKVIKAMV
1d6jA           ---------SALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
1t3wA           -------------------------------------KRTTXRILIGVQNPELATLVPPLENLDENKPGL
1g6oA           EQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKHHK
1bgxT2          ------------------------------------------RGMLPLFEPKGRVLLVDGHHL-------
1afrA           -----------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQV
1iioA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1xbtA1          ------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRALPA
1vplA           KDLRKRI--GKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEV
1yvuA2          ---------------KGIKLKIK-GKSLILAQTREEAKEKLIPVIN----KIKDVDLVIVFLEFLLYDFV
1jb1A           -----------RRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVG
1zp6A1          ------------------------GNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRI
1atrA1          ---------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKR
1grqA           ------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQ
1ffhA2          ---------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA--------AD
1e6cA           ---------------------------IFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVAD
1qhdA1          SGIKFINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEYA-IPVGPVFPPGMNWTDLITNY
1l7lA           -------------WKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICH
1urjA           EALCERLGLLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDIAEPFNANHR
1bs2A1          ----------------------------------------------------------------------
1g8yA           INILEAFA-AAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQL-----------------AAQIAGGP
1tljA           --LVWEE--LREKALNKIYHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSGRITIVDAEMPW
1ni3A1          ---------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKVAV
1ckvA           AGIMGLKKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTIKANGKIEVDDEI
3cddA2          GGKIYQGWTGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPS
1lw7A2          -------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGDEQ
1udwA           ------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVSEQKAK
1cd5A           KHVVTFNMDE-YVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKVGNDGHIA
1s9hA           ELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFP--FNDCV
2qgmA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           SYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGA-----------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f46A           ---------------------------------------IIMNVAAHHGSELNGELLLNS----------
1l1oA           --------DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDG--EGKNGTIELMEPLDEISGI
1jqjA3          GCDLLKQAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEIGFNVS
1e3mA2          TEGRHPVVELNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGPIDR
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1n25A           -----------------MVYNIPKKRYWLFKGPIDSGKTTLLELCGGKALNVNLPLDRLNFELGVAIDQF
1f8xA           ----------------------------------------------------------------------
1viaA           ---------------------------IVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKSEI
1zbsA1          ----------------------------------------------------------------------
1g6hA           ENIVKYF--GEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAE
1esmA           LNFYISSNLRRQAEQFLGTNGQRIPYIISIAGSVAVGK------------------STTARVLQALLSRW
2fggA1          ----------------------------------------------------------------------
1tmkA           ------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLIN
1cr0A           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-KKVGLAMLEESVEET
1vhhA           ----------------------------------------------------------------------
2ancF1          ------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFR
1ii8.1          ----------------------------------------------------------------------
1fl9A           EFSMLRF--GKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNI--
1zs3A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1ak2A1          ------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSEL
1ovmA2          PDICWVGCANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRG
1np6A           ------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAG
1mm8A           ----------------------------------------------------------------------
2f9hA1          -------------------------------------------------------------------TEI
1xl3C1          ----------------------------------------------------------------------
2gtlM1          AAHRKSFFPNRVWATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYG-VICDFNLGDDDHV
1yj5A2          ---------------------------VAV-GFPGAGKSTFIQEHLVSAGYVHVNRDTLGWQRCVSSCQA
1gm5A1          ----------------------------------------------------------------------
1b77A2          --------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVEDSGLT
1dnpA2          ----------------------------------------------------------------------
2vnuD1          RRAAELL--DKRIVISIDSWPTTHGHFVRDLGTIESAQAETEALLLE-----------------------
1mi8A           KDLLDEKDFE-IWAINEQTMKLESA-KVSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDEL
2hydA2          ----------------------------------------------------------------------
1q3tA           ------------------------TIQIAIDGPASSGKSTVAKIIAGFTYLDTGAMLKNQLGVEEVEALL
1pf4A2          ----------------------------------------------------------------------
1w1wA           -------------------VGFGESNFTSIIGPNGSGKSNMMDAISGNKLVELMRIISRNGDLENENILI
2pa7A1          ----------------------------------------------------------------------
1tueA           QQIEFITF---LGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTD
1sbxA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l3aA           ---------------------------------------------------FVGYSIYKGKAALTVEPRS
1e2hA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRLGASETIANI
1pgsA2          DGVPYGKAHTLLKKNIQLPTNTEKAYLRTTIGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGA
1t9hA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1g8fA3          ---------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHTELLSQD
1ckeA           ---------------------------ITIDGPSGAGKGTLCKAMAQWHLLDSGAIYRHHVDVASEDAPL
1yr6A1          ---------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYE
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------GIVIDIMPVKVPRVIGKNKSMYETLTSKSIFV--ANNGRIWAFSEEILI-----
1bccF           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1odfA           ---------------------------IFFSGPQGSGKSFTSIQI------------YNHLMEKYGGEKS
1oy5A           ----------------------------------------------------------------------
1mkyA1          --------------------------TVLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVF
1oa8A           ----------------------------------------------------------------------
1xzpA1          GEVVTRLERIKEKLTEELKKADAGILLNRGQEIFERGSDSLITNLRQKQLLENVKGHLEDAIKSLKEGME
1tpzA           IELRMRKGNAISDALKEID---SSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTM-----
1dwmA           ----------------------------------------------------------------------
1lnzA2          --------------------------DVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXVETD
2gujA1          ---------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNFDS--AKI
2cxxA1          --------------------------TIIFAGRSNVGKSTLIYRLTGKKVR-------------------
1zd9A1          --------------------------ELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNV
1dekA           ---------------------------IFLSGVKRSGKDTTADFIMPIKDALAYAWGVFAANTDYPXLTR


                         .         .         +         .         .         .         .:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
1b0uA           GQLLTMVFQHFNLWSMTVLENVMEAPIQVLGLSKHDARERA---LKYLAKVGIDERAQGKYPVHLSGGQQ
1sgwA           FLPEEIIVPRKISVEDYLKAVASLYGVKVNKN------------EIMDALESVEVLDLKKKLGELSQGTI
1pf4A1          RRHFALVSQNVHLFNDTIANNIAYAAEEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQR
1q3hA           MPGTIKENIIFGVSYDEYRYKSVV---KACQLQQDITKFAEQDNTVLGEGGVTL-----------SGGQR
1e69A           ELVFEENGEEITVARELKRTGEVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEK
1l7vC           ALHRAYLSQQQTPFATPVWHYLTLHQHDKT---RTELLNDV-------AGALALDDKLGRSTNQLSGGEW
1ji0A           INRIALVPEGRRIFELTVYENLXXGAYNRKDKEGIKR-----DLEWIFSLFPRLKERLKQLGGTLSGGEQ
1m3eA1          LLQISSYVGENAEFERQYLAGELEV-ELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKD
1mukA           RKYFAQTLFMAKTVSGNAIDSALLRLRTLGAKALTAQLLMVGLQES----------EADALAGKIMLQDV
1e9rA           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWA------SYGRLLLRETAKKLAL
1poiA           YINCYTANSGVTNVSRRFRKWFEAGKEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRK
1khbA1          LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGID-EPLASGVTITSWKNKEW
1c4oA1          RELFPENAVEYFISYY-----DYYQPEAYVPGKDLYIEKDASINPEIERLTRSLLTRRDVIVVASVSAIY
1nijA1          GDRATQIKTLTNGCCCSRSNEL----EDALLD----LLDNLDKGNIQFDR-LVIECTGMADPGPIIQTFF
1qhlA           D-TINSRHQRGRDRKVDIKPFAIQGLPMSVQPTLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHS
2gk3A1          ---LKVLFIGESWHHXIHSKGYDSSKYEEGATWLLECLRKGGVDI----DYXPAHTVQIAFPESIDELNR
2yyeA2          MLDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQLSEN---LVKKKIYPKGAIENLNFVKNYLKSNLDN
1jalA1          AEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIR----ETDAIGHVVRCFENIDPLDDIDTIN
1mjgM           KLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWL------RVSKDAVAKGFRFKNY
2iqhA1          IRMIKRGINRRTRAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNA---EFEDLIFLARSALILRGSVA
1bmfA3          RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR
1ex6A           KDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQV-------SKSGKTCILDIDMQGVKSVKAI
1pv4A3          TEXQRLVKGEVVAST-------------FDEPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITRLARA
1kgdA           YFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVE------------PQALKVLR
1jbkA           LVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEYR
2axpA1          LADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGGKDID
1t06A           NYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVADKWIASGDELK---MSA
1jjvA           SK-IVEHFGAQILNRAALRER------VFNHDEDKLWLNNLLHPAIRERMKQKL-----------AEQTA
1rkbA           DEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTLYERLETRGYNEKKLTDN
2v3jA1          THQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFS--GLXVQLLHKLSIRSEEKLLKV
1jqjA2          -------------------SEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDG
1ohcA1          KSASNVHYFSIDLEYENFYADLNLAMVYRYCCKINKKLKSITMLR-------------KKIVHFTGSDQR
2gx8A1          ----TAHPYEEVAYVYPLDNKGETLGLGKIGYLQEEM--------TLGQFAEHVKQSLDVKGARVVGKLD
1d6jA           KDLGFSEADRNENIRRIAEVAK------------LFADSNSIAITSFISPYRKDRDTARQLHEVATPGEE
1t3wA           GLFRELVNTCLSQPGLTTGQLLEHYRGTN-NAATLEKLSXWDDIADKNIAEQ-------------TFTDS
1g6oA           -NYTQLFFGGNITSADCLKSCLRXR----PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAF
1bgxT2          ------AYRTFHALGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAP
1afrA           RELRESPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYT
1iioA           -------------------SHMKMGVKEDIRGQIIGALAGNSPEELMAALPNGPDTTCKSGDVELKASDA
1d8jA           -------------LSGSSGYKF------GVLAKIVNYMKTRHQRGD--THPLTLDEI-LDETQHLDIGLK
1xbtA1          CRDVAQEALGVAVIGIDEGQFFPDIVEFC--EAMANAGKTVIVAALDGTFQ-----------RKPFGAIL
1vplA           RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSE----IEEMVERATEIAGLGEKIKDRVSTYSKGMV
1yvuA2          KREKXIPSQVI-LNRTLKNENLKFVLLNVAEQVLAKT---GNIPYKLKEIEGKVDAFVGIDISRITRDGK
1jb1A           APPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPD----QLIFDVPVPKITVPVKVGRN
1zp6A1          DPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCL
1atrA1          FDDAVVQSDMKHWPFMVVNDAGKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQR
1grqA           SAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDV----FLGGAAAQERWRSFVGDLDV
1ffhA2          TQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEK------------ARLEARDLILVDTAGRLQ
1e6cA           VVAAEGWPGFALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRTGR
1qhdA1          SP-SREDNLQRVFTVASIRSML------------------------------------------------
1l7lA           DAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKD---------
1urjA           SIGEKFTYPLPFFLFEAVVGPAAVALRSRNVDAVARAAAHLAFDENHE--GAALPADITFTAFAGGFEQR
1bs2A1          ---------------------------------------------------------LQYAHSRLRSVER
1g8yA           DLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLK
1tljA           DRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIEDILKIAREAGFKHSGILATNQ
1ni3A1          PDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVR----AFDDAEI
1ckvA           SELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSE-LMGLDRK--------------------------
3cddA2          YDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGE
1lw7A2          AMQYSDYPQXALGHQRYIDYAVRHSH---------------------KIAFIDTDFITTQAFCIQYEGKA
1udwA           ALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEV
1cd5A           FNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTVMILVLGSQKALALQAAVEGCVN
1s9hA           DKMVIWWEEGKMTAKVESAKAILGGSK---------VRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNS
2qgmA1          ---------------------------------------------VQKNIVKSIQSQANPLKTIEPSKPF
1o7d.2          ----------------------------------FAFCRKLNISI-CPLTQTAERFQV----IVYNPLGR
1i1qA           ---VGYFTAHGLDTCIVIRSALVENG-IATVQAGAGIVLDSVPQSEADETRNKARAVLRAIATAHHA---
1es6A2          ----------------SFHPKLRPI---LLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEV
1f2t.1          -------------------------------------------------------------GERIALGLA
1j1zA2          ---ANLLHISYEGGLEDPWAEPPKGRMTQDPEEAPDAPEYVEVEFF------------EGDPVAVNGERL
1f46A           IQQAGFIFGDMNIYRHLSPDGSGPALFSLANMVKPGTFDPEMKDFT---TPGVTIFMQVPSYGDELQLFK
1l1oA           VEVVGRVTAKATILCTSYVQFK-EDSHPFDLGLYNEAVK------IIHDFPQFYPLGI------------
1jqjA3          YVLLNALKCENVRMMLTDSVSSVQIEDAAS-QSAAYVVMPMRL---------------------------
1e3mA2          IFTR--VGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFE
3cddA1          --------------------------GVS-LILGDNVKAARGRFSWRQRFSKFT-----------IKAAK
1dhyA1          -------------------------------YLGFAVKDVPAWDHFLTKSVGLMAA-----------GSA
1n25A           LVVFEDVKGTGGESRDLPINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFV
1f8xA           --------------------------------------------------------TIYFGAGWFTDRQN
1viaA           FEQKRENFFREQEQKXADFFSSCEKACIATGGGNVSNLEKAGFCIYLKADFEYLDEISKRPLFYDEIKAK
1zbsA1          --------------------------EGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRL
1g6hA           LYHYGIVQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFSHLYDRKAGELSGGQM
1esmA           PEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESY-----DXHRLVKFVSDLKSGVPNVTAPVYSHLIY
2fggA1          -------------------------------GKTCQIDVLIEEHDERTRAKARL-----------SWAGR
1tmkA           EYLTDDSFQLSDQAIHLLFSA-------NRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDL
1cr0A           AEDLIGLHNRVRLR-----QSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETD---------RL
1vhhA           -----------------------------------------------NVAEKTLGASGRYEGKITRNSER
2ancF1          QKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSH---YAEYDYLIVNDDFDTALTDL
1ii8.1          --YKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLA
1fl9A           -AGKMIYHFDLY-RLADPEELEFMGIRDYFNTDLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTN
1zs3A1          --DKAEIDHHKPTALGHVLSNLFIENIRLT---------QAGIYAKSPVKCEYLREIAQREVEYFLLDEN
2vgmA3          -----------------------------------------------IMVMDEFLLHLNKDDDKAWYGEK
1v47A1          ----------------------------------------------------------------------
1ak2A1          GKKLKATMDAGKLVSDEMLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIP
1ovmA2          ELLHHTLGDGEFRHFYHMSEPITVAQAVLTENACYEIDRVLTTMLRERMLPADVAKKAATP---------
1np6A           AAQTIVASQQRWALMTETPDEEELDLQFLASRMDTS-------------------KLDLILVEGFKHEEI
1mm8A           ------------DWAKSVFSSAALGDPRRTARLVNVAAQLAISSEGSKAAQEGAYRFIRNPNVSAEAIRK
2f9hA1          GKHAIDDSEKXIILGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKI-----GDTNYTITKVGSFANSNL
1xl3C1          ----------------FMGDIVALVXRWAGIHDIEHLANAFSLPTPEIXVYQDLXRMFRLFPLGVFSDEE
2gtlM1          VPSSLFVCAHFNAQ--------------------------------------------------------
1yj5A2          ALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXFS
1gm5A1          ------------LFWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLEN-----KDLEEKLQ
1b77A2          RPKYSLTLTDYDGNFVINMANMKIQMLWGAGDKVAAKFESSQVSY-------------------------
1dnpA2          --------------------HLVWFRQDLR---LHDNLALAAACRNSSARVLALYIATPRQWATHNMSPR
2vnuD1          ----------------------------------------------------------------------
1mi8A           SLKEHIARKSDISWDSIVSITETGV---------------------------------------------
2hydA2          ----------------------------------------------------------------------
1q3tA           ADQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDGR-
1pf4A2          ----------------------------------------------------------------------
1w1wA           KAKNFLVFQGDVEQIAALSRMFTFDYVSDHLDAIYRELTGNASLTKYHATPPLKRFKDMEY---LSGGEK
2pa7A1          ----------------------------------------------------------------VLVCLN
1tueA           TK-VAMLDDATTTCWTYFDTYMRNALDGNPIS--------------------------------------
1sbxA           ---------------------------------------------------------------DRSTERC
1a4iA2          ----------------------------------------------------------------------
1l3aA           PEFSPLDSGAFKLSREMVMLQFAPARKQVFSLSVTEIGSIISLGT----------KDSCEFFHDPNKGRS
1e2hA           YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHARYLMGSMT
1pgsA2          LGCSANINNQSPGNWTPDRAGWCPGMAVPTRIDVLN----------------------------------
1t9hA2          --ELGYTFPDIREKSSCKFRGCLHLKE--PKCAVKQAVEDGELKQYRYDHY-----------VEFMTEIK
1em8A           ----------------------------------------------------------------------
1iqrA2          ---------------------HRGDLRLHDHPALLEALARGPVVGLVVLDPNN-----------LKTTPR
1g8fA3          FIGSGSGLIIPDQWEDDKDSVVGKQNVYLLDTSSSADIQLESADEPISHIVQKVVLFLEDNGF-------
1ckeA           ASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDM
1yr6A1          PDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVR
1uouA3          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ---NAAGFNKYGLMDDTIYENDDVKEAIRRLPENLYD-DRMFRIKRALDLN-------MRQQILPKEQWT
1g31A           ----------------------------------------------------------------------
1odfA           IGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEG
1oy5A           ------------------------------------------------RVKKIVDMEISLGDFILSGGEI
1mkyA1          DNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDE---SLADFLRKSTVDTILVANKAENLREFE
1oa8A           ---------------------------------------------------------------QFAVGEH
1xzpA1          RALNLLDEVTGRSFREDLLDTIFS----------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1lnzA2          DGRSFVXA--------------------------------------------------------------
2gujA1          ASLVPFTFEDFDVPEK------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          TIKLWDIGGQ------------------------------------------------------------
1dekA           KEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKE--SVNFVAFNKITDVINNIE


                         *         .         .         .         .         +         .:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTI
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGTMVVVTHEMGFARHVSHVIFLHQGKI
1sgwA           RRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREE-LSYCDVNENLHKYS-
1pf4A1          QRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEI
1q3hA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFECVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1e69A           ALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVVNGV-
1l7vC           QRVRLAAVVLQITPLLLLDEPXNSLDVAQQSALDKIL-SALCQLAIVXSSHDLNHTLRHHRAWLLKGGKX
1ji0A           QXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQETTILLVEQNALGALKVHYGYVLETGQI
1m3eA1          GSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLPXCKAETTVVEVEEI
1mukA           NTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLP----KDGRH----LNTDIPPRMGWLAILRFLGAGMV
1e9rA           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKTSARFVLSDKLPEHVTMPDGDFSIRS--
1poiA           TLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDV-------------------------------------
1khbA1          SSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMR
1c4oA1          GLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERG------------------
1nijA1          SHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGY--ADRILLTKTDVAGEAEKLERLARINARAP
1qhlA           LMFDLLRSASDRSKFYRLIEASLGISSAITRSLRDYLLPE------------------------------
2gk3A1          YDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVKN--GGGLLXIGGYLSGIEAKANYKNTVLAEV
2yyeA2          WKLILLSDPVTSGGLLFTINKE------KLEKIDETAKELEVNYWIIGETIAENVL--------------
1jalA1          TELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENMIRSVGLDKEELQAKSYNFLTLKPT
1mjgM           GEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVKYKERDDRMRGLTDETVDTFYAPNHVCIVTPERV
2iqhA1          HKSCLPACVYGSAVASGYDFEREGYSLVGIDP-----FRLLQNSQVYSLIRPNENPAHKQLVWMACHSAA
1bmfA3          QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYITNVISITDGQI
1ex6A           PELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEHDKVIVNDDLDKAYKEKDFIFAE----
1pv4A3          YNTVVPAVLTGGVDANALHRPKRFFGAARNVEEG----GSLTIIATALIDTGSKXDEVIEEFKGTGNXEL
1kgdA           TAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHEEAV-------
1jbkA           QYIEKDAALERRFQKVFVAEPSVEDTI-------------------------------------------
2axpA1          SILELYREVXSNAGLHTYSWDTGQWSSDEIAKDI------------------------------------
1t06A           GWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSANFLNTVAISHEKAVEIKEVGIVEVKRD
1jjvA           PYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELA
1rkbA           IQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNV-DQILKWIEQWIKDH------------------
2v3jA1          IKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGLSNYPL
1jqjA2          HRLAVCSMPIGQ----SLPSHSVIVPRKGVIELMRMLD-GGDNPLRVQIGSNNIRAHVGDFIF-------
1ohcA1          KQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYITLLDCFHAVK--KAM-----------
2gx8A1          DKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHMMLGLNIVDPGHNVEKVMKQKQLQEKVDAKK
1d6jA           TGLPFVEVYVDVPVEAPYEAPAVKNYELPVQDAVKQIIDYLDTKGYL-----------------------
1t3wA           LNHXFDSLLELRQEELIARERTHGLSNEERLELWTLN-QELA----------------------------
1g6oA           IRLASSNSAARNIKESLIEGFKDLI-----------------DXIVHINHHKQ------CDEFYIK----
1bgxT2          TPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKEKEGYEVRILTADKDLYQLLDRIHVLHPEGY
1afrA           SFQERATFISHGNTARQAKEHGDIKLAQICG-----TIAADEKRHETAYTKIVEKLFEIPDGTVLAFADM
1iioA           GQVLTADFPFKSAEEVADTIVN------------------------------------------------
1d8jA           QKQWLMTEAVNNPKIEVIDGKYAFKPKYNVR---------------------------------------
1xbtA1          NLVPLAESVVKL----------------------------------------------------------
1vplA           RKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQSQEGLTILVSSHNMLEVEFLDRIALIHNGTI
1yvuA2          TVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD-------VFSLLEKLGFKKGSKIVVHRDGRL
1jb1A           LAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI-------------------------------------
1zp6A1          DRGGDSL--SDPLVVADLHSQFADLGAFEHHVLPVS-GKDTDQQSAINALQ-------------------
1atrA1          QATKDAGTIAGLNVLRIINEPTAAAIAYGLD---------------------------------------
1grqA           LWVGV------RCDGAVAEGRETARGDRVAGMAAKQAYHEGVEYDVEVDTTHKESIECAWAIA-------
1ffhA2          IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAEKVGVTGLVLTKLDGDAGAALSARHVTGKPI
1e6cA           PIAEEMEAVLREREALYQDVAHYVVDAQPPAAIVCELMQTMR----------------------------
1qhdA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1urjA           LASVMAGDAALALESIVDEPPTDISAQDTAAARANAV-GAYLARLVGAMVFSTNSALHLTEVDDAGPAHS
1bs2A1          NASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFK-LTHQVSSCYDVLWV
1g8yA           RAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDRWQSYLSSMTSAEA
1tljA           KGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLRGKQKMNLLKD------------------
1ni3A1          IHVEGDVDPIR--DLSIIVDELLIKDAEFVEKHLEGLRK-------------------------------
1ckvA           ----------------------------------------------------------------------
3cddA2          TPHELLARLAKQRGVLLTSDTFGNLVI-------------------------------------------
1lw7A2          HPFLDSXIKEYPFDVTILLKNNTELKKLLDKPYIEIESPSYLDRYNQVKAV-------------------
1udwA           RDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNL
1cd5A           HMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNEL-EAENIK--------------------------
1s9hA           TTFEHQQPLQDRMFKFELTRRLDHDFGVTKQEVKDFFRWAKDHVVEVEHEFYV-----------------
2qgmA1          EDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKGN
1o7d.2          KVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMPRDLVIQNEYL
1i1qA           ----------------------------------------------------------------------
1es6A2          PETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVI-TQDCDT--------------------------
1f2t.1          FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
1j1zA2          SPAALLQ----RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETGTILYHARRAVESLTLREVLHQRDMLS
1f46A           LMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDII-REVKDA--------------------------
1l1oA           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          LTQLPEK-----XEGVANVHLDALEHGDTIAFXHSVQ-DGAASKSYGLAVAALAGV--PKEVI-------
3cddA1          ADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIKLWNINTLVPVIDEIXG
1dhyA1          GDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADKQAGVAFTRGDEALMQQRKVMGLLCLQ
1n25A           KQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPEFAQSIQSRIVEWKERLDKEFSLSVY--
1f8xA           KAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDWATATYNNDLNGIKTNDIMLGVYIPDE
1viaA           KLYNERLSKYEQKANFILNIENKNIDELLSE---------------------------------------
1zbsA1          FIGSLLKGQXPE---GLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSF
1g6hA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHLELKAKGITFLIIEHLDIVLNYIDHLYVMFNGQI
1esmA           DVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDIYVDAPEDLLQTWYINRFLKFREGAF
2fggA1          QXVGVGLARLDP-----ADEPVAQIGDELA---IARALSDL-ANQLFALTSSDI--EAST----------
1tmkA           DWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVKQ-------TFMKLLDKEIRKGESITIVDVTNK
1cr0A           LAKLAYMRSGLGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQIIALERNQL
1vhhA           FKE---LTPNYNPDIIFKDEENTGADRLMTQRCKDKLNANQWPGVKLRVTEGWDEDGHHSEESLHYEGRA
2ancF1          KTIIRAERLRMSRQKQRHDALISKLL--------------------------------------------
1ii8.1          FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRISLENG
1fl9A           LGKNIISAF-------------------------------------------------------------
1zs3A1          EIVPSTTEEFLKYHKFITEDPKAKYW--TDEDLLESFIVDFQ-AQNMFITRAIKLANKEEKFA-LAAGVV
2vgmA3          -EVVKAAEYGAISYLLLTDKVLHSDNIAQREEYL-KLMDSVESGKALVLSTLHSLGEELDQLTGI-----
1v47A1          -ALEIGEDERLD-LENLATGAFFPVKGFMTRSVAHEMRLPTGEVWTIPILLQFREKPRVNTVALLHGGER
1ak2A1          DSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKIHSAIDASQTPDVVFASLAAF-------
1ovmA2          ----------------------------------------------------------------------
1np6A           AKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVADFVVEWMQK----------------
1mm8A           AGAMQTVKLAQEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQEW
2f9hA1          QSIAHSTLIFADAPTDEDDVIRNGVY----LTPHQLPKIT-IGTTIDYL---------------------
1xl3C1          QRQNLLQMCQNAIDMAIESE--------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1yj5A2          YRKQFEPPTLAEGFLEILEIPFRLQEHL--DPALQRLYRQFSE---------------------------
1gm5A1          AFLDYVKE------IPNLPEARKRYRIQKSLEMIEKL-RSWFLIDYL-----------------------
1b77A2          ----------------------------------------------------------------------
1dnpA2          QAELINALNGLQIALAEKGIPLLFREVDDFVASVEIVKQAENSVTHLFYNYQYEVNERADVEVERALRNV
2vnuD1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1q3tA           ---DIGTVVLPQAELKIF------LVASVDERAERRYKENIAKGIETDLETLKKEIAARD----------
1pf4A2          ----------------------------------------------------------------------
1w1wA           TVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRPDLQFIVISLKNTMFEKSDALV-------
2pa7A1          GSCRVILDDGNIIQEITLDSPAVGLYV-GPAVWHEMHDFSSDCVMMVLASDYYDETDYIQYDNFKKYIAK
1tueA           ----------------------------------------------------------------------
1sbxA           EGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDEL-HIYCSRCTADQLEILKVGILPFSPSCGL
1a4iA2          ------------APEILNGKE---ISAQIRARLVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAA
1l3aA           DEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENVTKAEFAVLVSAF------------------
1e2hA           PQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLNTVRYLQCGGS
1pgsA2          ----------------------------------------------------------------------
1t9hA2          DRK-------------------------------------------------------------------
1em8A           ----------KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRKRVLIACEDEKQAYRLEALWARPAESF
1iqrA2          RRAWFLE------NVRALREAYRARGGALWVLEGLPWEKVPEKAKAVYALTSHTPYGRYDGRV-------
1g8fA3          ----------------------------------------------------------------------
1ckeA           GTV-----------VFPDAPVKIFLDASSEERAHRRMLQKGFSVNFERLLAEIKLVPAADLVLDSTTLSI
1yr6A1          LMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALDLLSEEEKERHRKYFEDIDYLTA
1uouA3          --------------------------REQEELLAPADGTVELVLPLALVLHELGALRLGGAELLVDVGQR
2je6I3          ----------------------------------------------------------------------
1bccF           KYEEDVPYLEPYLKEVI-----------------------------------------------------
1g31A           -----LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEELCVVHSVGPDVPEGVGDLTSLPVGQI
1odfA           DRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENDLLTGDMVDVNAKL----------------------
1oy5A           VALAVIDAVSRVLPGVLSEP--------------------------------------------------
1mkyA1          REVKPELYSLGFGEPI------------------------------------------------------
1oa8A           RAQVSVEVLVEY-PFFVFGQGWSSCCPERTSQLFDLPCSKLSGDVCISLTL-------------------
1xzpA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dwmA           ----------------------------SGNMAAATVERENRNHAIVLKEGSAMTKDFRDRVWVIVNDHG
1lnzA2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1dekA           DQWSVRRLMQALTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTDHEMDAARAMGATVIHVV---


                         .         .         .         *         .         .         .:630
query           EMQGSPDYLRKTNERYQKLKAIDEGR
1b0uA           EEEGDPEFGNPQSPRLQQF-------
1sgwA           --------------------------
1pf4A1          IERGRHA-------------------
1q3hA           YFYGTFSELQSLRPDFSSK-------
1e69A           --------------------------
1l7vC           LASGRRE-------------------
1ji0A           VLEGKASELL-DNEXVRK--------
1m3eA1          VDIGSFA-------------------
1mukA           MTATGV--------------------
1e9rA           --------------------------
1poiA           --------------------------
1khbA1          SEAKIIMHD-----------------
1c4oA1          --------------------------
1nijA1          VYTVTHGDI-----------------
1qhlA           --------------------------
2gk3A1          LPVIXLDGDDRVEKPE----------
2yyeA2          --------------------------
1jalA1          MYIANVNEDGFENNPYLDR-------
1mjgM           GLCGAVSWLD----------------
2iqhA1          FEDLRVSSFIRGTKVVPRGKLSTRGV
1bmfA3          FLETELFYKGIRPA------------
1ex6A           --------------------------
1pv4A3          HLSRKI------AEKRVF-PAIDYNR
1kgdA           --------------------------
1jbkA           --------------------------
2axpA1          --------------------------
1t06A           NKKSSLLNA-----------------
1jjvA           QNLPHLQKVLELHQFYLQQ-------
1rkbA           --------------------------
2v3jA1          SASVAC--------------------
1jqjA2          --------------------------
1ohcA1          --------------------------
2gx8A1          LNVHIHASQLHTDPFI----------
1d6jA           --------------------------
1t3wA           --------------------------
1g6oA           --------------------------
1bgxT2          LITP----------------------
1afrA           MRKKISM-------------------
1iioA           --------------------------
1d8jA           --------------------------
1xbtA1          --------------------------
1vplA           VETGTVELKERYKAQN----------
1yvuA2          YRDEVAA-FKKYGELY----------
1jb1A           --------------------------
1zp6A1          --------------------------
1atrA1          --------------------------
1grqA           --------------------------
1ffhA2          YFAGLEPFYPE---------------
1e6cA           --------------------------
1qhdA1          --------------------------
1l7lA           --------------------------
1urjA           --------------------------
1bs2A1          AGQTEELAT-----------------
1g8yA           EEWGVDDDQRRFFVRFGVSKAN----
1tljA           --------------------------
1ni3A1          --------------------------
1ckvA           --------------------------
3cddA2          --------------------------
1lw7A2          --------------------------
1udwA           V-------------------------
1cd5A           --------------------------
1s9hA           --------------------------
2qgmA1          PREFLKLLYP----------------
1o7d.2          RARFDPN-------------------
1i1qA           --------------------------
1es6A2          --------------------------
1f2t.1          KVE-----------------------
1j1zA2          PKYAELVYYGFWYAPEREA-------
1f46A           --------------------------
1l1oA           --------------------------
1jqjA3          --------------------------
1e3mA2          --------------------------
3cddA1          LDEESILFSEDDAGR-----------
1dhyA1          DPFGLPLEI-----------------
1n25A           --------------------------
1f8xA           EDVGLGMELGYALSQGKYV-------
1viaA           --------------------------
1zbsA1          DD------------------------
1g6hA           IAEGRGEEEIKSDPKVVEI-------
1esmA           TDPDSY--------------------
2fggA1          --------------------------
1tmkA           GIQEVEALIWQIVEPV----------
1cr0A           --------------------------
1vhhA           VDITTSDRDRSKYGMLARL-------
2ancF1          --------------------------
1ii8.1          SSKV----------------------
1fl9A           --------------------------
1zs3A1          ELYGY---------------------
2vgmA3          --------------------------
1v47A1          VALLHV--------------------
1ak2A1          --------------------------
1ovmA2          --------------------------
1np6A           --------------------------
1mm8A           WMRPDDPADADEKESGK---------
2f9hA1          --------------------------
1xl3C1          --------------------------
2gtlM1          --------------------------
1yj5A2          --------------------------
1gm5A1          --------------------------
1b77A2          --------------------------
1dnpA2          VCEGFDDSVILPPGAVM---------
2vnuD1          --------------------------
1mi8A           --------------------------
2hydA2          --------------------------
1q3tA           --------------------------
1pf4A2          --------------------------
1w1wA           --------------------------
2pa7A1          --------------------------
1tueA           --------------------------
1sbxA           ITKTDAE-------------------
1a4iA2          EEIGIKA-------------------
1l3aA           --------------------------
1e2hA           WREDWGQLSGPRPHIGDTLFTL----
1pgsA2          --------------------------
1t9hA2          --------------------------
1em8A           VPHNLAG-------------------
1iqrA2          --------------------------
1g8fA3          --------------------------
1ckeA           E-------------------------
1yr6A1          RLKLDPSMQGLMAYK-----------
1uouA3          LRRGTPWLRVHRDGPALSG-------
2je6I3          --------------------------
1bccF           --------------------------
1g31A           RNVPHPFVAL----------------
1odfA           --------------------------
1oy5A           --------------------------
1mkyA1          --------------------------
1oa8A           --------------------------
1xzpA1          --------------------------
1tpzA           --------------------------
1dwmA           VVTSVP--------------------
1lnzA2          --------------------------
2gujA1          --------------------------
2cxxA1          --------------------------
1zd9A1          --------------------------
1dekA           --------------------------