[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99890.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lmzA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1keaA.bssp"
#ERROR : Can't open dsspfile "1pu6A.bssp"

## Summary of PDB Search
:183
    4e-60  49%  1lmzA  [a.96.1.4] 3-METHYLADENINE DNA GLYCOSYLASE I (TAG)
    3e-27  13%  1cjaA  [d.144.1.3] PROTEIN (ACTIN-FRAGMIN KINASE)
    1e-20  14%  1keaA  [a.96.1.2] POSSIBLE G-T MISMATCHES REPAIR ENZYME
    4e-09  17%  1pu6A  [a.96.1.5] 3-METHYLADENINE DNA GLYCOSYLASE
:183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKCAWIYGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
1lmzA           -RCGWV-SQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAA
1cjaA           -------------VSSNSEEGTNMLECLDKSFRVITTLANQANILLMELV-RGITLNKLTTTSAPEVLTK
1keaA           KKRKVF--VSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCF--EDILK
1pu6A           --------LKALKSLDLLKNAPAWWWPNALKFEALLGAVLTQNTKFEAVLKSLENLKNAFDEINLKKIAY


                         .         .         *         .         .         .         .:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGIINNQPIINNFKNPEEIPTKTK
1lmzA           MQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTP
1cjaA           STMQQLGSLMALDVIVNNSDRLPIAWTNEG--NLDNIMLSERGATV------------------------
1keaA           TPKSEIAKDIKEIGLS--NQRAEQLKELARVVINDY---GGRVPRNRKAILDLPGVG-------------
1pu6A           IEFSKLAECVRPSGF--YNQKAKRLIDLSGNILKDFQSFENFK---------------------------


                         +         .         .         .         .         *         .:210
query           LSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCYxxx
1lmzA           ASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC---
1cjaA           -------------------------------------------
1keaA           -------------------------------------------
1pu6A           -------------------------------------------