[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD99944.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v2xA.bssp"
#ERROR : Can't open dsspfile "1j85A.bssp"
#ERROR : Can't open dsspfile "1gz0A1.bssp"
#ERROR : Can't open dsspfile "1ipaA1.bssp"
#ERROR : Can't open dsspfile "1gqiA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1z67A1.bssp"

## Summary of PDB Search
:170
    2e-37  29%  1v2xA  [c.116.1.1] TRNA (GM18) METHYLTRANSFERASE
    2e-36  43%  1j85A  [c.116.1.1] YIBK
    2e-34  20%  1gz0A1 [c.116.1.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
    5e-27  23%  1ipaA1 [c.116.1.1] RNA 2'-O-RIBOSE METHYLTRANSFERASE A:106 -- 263
    1e-20  11%  1gqiA2 [d.92.2.2] ALPHA-GLUCURONIDASE A:5 -- 151
    4e-11   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    9e-08   9%  1z67A1 [a.259.1.1] HYPOTHETICAL PROTEIN S4005 A:3 -- 131
:170

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
1v2xA           ---TVLLENVHKPHNLSAILRTCDAVGVEAHAVNPTGG-VPTFNETSGGSHKW--VYLRVHPDLHEAFRF
1j85A           ---DIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLES
1gz0A1          ---LLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTXRX
1ipaA1          ---ILVAVGLEKPGNLGAVLRSADAAGAEAVLVAG-GVDLYSPQVIRNSTGVVFSLRTLAASESEVLDWI
1gqiA2          ---QKQIRHLHVAGD-SPTINAAAQRGLSGLLNKPIVARDEKLKDYSLVIGTPDNSPLIASLNLGERLQA
1mjgM           GMTPSGMTFSTLAGMIGGGTQTPGFMGGRTYIVSKKFISADGGIARIVWMPKSLKHDEFVRSSVEEGLG-
1z67A1          ---QAILSWVEEQGGIQVLLEKLQAILSTWLSNQQRNQSVSGEQLESAGTNAVSDLGQKLGVDTSTASSL


                         .         .         *         .         .         .         .:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
1v2xA           LKERGFTVYATALDARDFREVDYT---KPTAVLFGAEKWGVSEEALAL-ADGAIKIPML-GMVQSLNVSV
1j85A           EKPKR-LFALTTKGCPAHSQVKFK---LGDYLMFGPETRGIPSILNEMPMEQKIRIPMT-ANSRSMNLSN
1gz0A1          LQEEN-IWIVGTAGEADHTLYQSKXTGR-LALVXGAEGEGXRR-LTREHCDELISIPXA-GSVSSLNVSV
1ipaA1          KQHNLPLVATTPHAEALYWEANLR---PPVAIAVGPEHEGLRAA-WLEAAQTQVRIPMQG-QADSLNVSV
1gqiA2          LGAEG---------YLLEQTRINK---RHVVIVAANSDVGVLY----GSFHLLRLIQTQ-HALEKLSLSS
1mjgM           ----------------------------------------------------------------------
1z67A1          LAEQL-PKIIDALGEVQANNDLLS---AGXELLKGK----------------------------------


                         +         .         .         .         .         *         .:210
query           TAAIVVYEALRQQGFPNLETTHTYENDKLx
1v2xA           AAAVILFEAQRQRLKAGL-----YDRPRL-
1j85A           SVAVTVYEAWRQLGYKGA------------
1gz0A1          ATGICLFEAVRQR-----------------
1ipaA1          SAALLLYEALRQR-----------------
1gqiA2          ------------------------------
1mjgM           ------------------------------
1z67A1          ------------------------------