[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00050.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs611.bssp"
#ERROR : Can't open dsspfile "2hgj51.bssp"

## Summary of PDB Search
:50
    3e-10  31%  1vs611 [g.41.8.6] 50S RIBOSOMAL PROTEIN L33 1:1 -- 54
    5e-10  48%  2hgj51 [g.41.8.6] 50S RIBOSOMAL PROTEIN L33 5:9 -- 53
:50

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
1vs611          -GIREKIKLVSSAGTGHFYTTTKNKTKPEKLELKKFDPVVRQHVIYKEAK
2hgj51          ------LLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHREVK