[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00071.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yqgA1.bssp"
#ERROR : Can't open dsspfile "2ahrA2.bssp"
#ERROR : Can't open dsspfile "1yqgA2.bssp"
#ERROR : Can't open dsspfile "2ahrA1.bssp"
#ERROR : Can't open dsspfile "1jaxA.bssp"
#ERROR : Can't open dsspfile "2i76A2.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "2f1kA2.bssp"
#ERROR : Can't open dsspfile "1vjpA1.bssp"
#ERROR : Can't open dsspfile "1i36A2.bssp"
#ERROR : Can't open dsspfile "1txgA2.bssp"
#ERROR : Can't open dsspfile "1tltA1.bssp"
#ERROR : Can't open dsspfile "1iukA.bssp"
#ERROR : Can't open dsspfile "1xeaA1.bssp"
#ERROR : Can't open dsspfile "1qmgA2.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "2nacA1.bssp"

## Summary of PDB Search
:264
    1e-28  23%  1yqgA1 [a.100.1.10] PYRROLINE-5-CARBOXYLATE REDUCTASE A:153 -- 263
    8e-28  32%  2ahrA2 [c.2.1.6] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE A:1 --
    3e-24  28%  1yqgA2 [c.2.1.6] PYRROLINE-5-CARBOXYLATE REDUCTASE A:1 -- 152
    2e-20  49%  2ahrA1 [a.100.1.10] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE A:153
    8e-14  15%  1jaxA  [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN
    2e-11  12%  2i76A2 [c.2.1.6] HYPOTHETICAL PROTEIN A:2 -- 154
    6e-11  14%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    1e-10  15%  2f1kA2 [c.2.1.6] PREPHENATE DEHYDROGENASE A:1 -- 165
    1e-10  12%  1vjpA1 [c.2.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE-RELATED A:0 --
    1e-09  29%  1i36A2 [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN MTH1747 A:1 --
    1e-07  17%  1txgA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+] A:1
    1e-07  16%  1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM
    1e-05  14%  1iukA  [c.2.1.8] HYPOTHETICAL PROTEIN TT1466
    2e-05  13%  1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122
    4e-05  21%  1qmgA2 [c.2.1.6] ACETOHYDROXY-ACID ISOMEROREDUCTASE A:82 -- 307
    2e-04  12%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    6e-04  19%  2nacA1 [c.2.1.4] NAD-DEPENDENT FORMATE DEHYDROGENASE A:148 -- 335
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
1yqgA1          ----------------------------------------------------------------------
2ahrA2          -KIGIIGVGKXASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAXSHQDLIDQVDLVILGIKP
1yqgA2          ----FLGGGNXAAAVAGGLVKQG--GYRIYIANRGAEKRERLEKELGVETSATLPEL-HSDDVLILAVKP
2ahrA1          ----------------------------------------------------------------------
1jaxA           MRVALLGTGNLGKGLALRLATLGHE---IVVGSRREEKAEAKAAEYASITGMKNEDAAEACDIAVLTIPW
2i76A2          --LNFVGTGTLTRFFLECLKIGYILSRS-----------IDRARNLAEVYGGKAATLEKHPEVVFVIVPD
1ks9A2          MKITVLGCGALGQLWLTALCKQGHEV-QGWLRVPQPYCSVNLGSIFNESLTANDPDFLATSDLLLVTLVS
2f1kA2          MKIGVVGLGLIGASLAGDLRRRGHY---LIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKIIFLCTPI
1vjpA1          VKVLILGQGYVASTFVAGEKLRKGEIEPYGELPIGFEDIKIVGSYDRAKIGKKLSEVVKQYWNDVDSLTS
1i36A2          LRVGFIGFGEVAQTLASRLRSRGVEVVTSLEGRSPSTIER----ARTVGVTETSEEDVYSCPVVISAVTP
1txgA2          MIVSILGAGAMGSALSVPLVDNGNEILKSISAGREHPRLGVKLNGVEIFWPEQLEKCLENAEVVLLGVST
1tltA1          LRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVHSST
1iukA           KTIAVLGAHKDPSRPAHYVPRY---LREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPP
1xeaA1          LKIAXIGLGDIAQKAYLPVLAQW-PDIELVLCTRNPKVLGTLATRYRVSATCTDYRDVLQYGVDAVXI--
1qmgA2          -QIGVIGWGSQAPAQAQNLKDSLVVKIGLRKGSNSFAEARAAGFSEENGTLGDMWETISGSDLVLLLISD
1e0dA1          KNVVIIGLGLTGLSCVDFFLARGVT-PRVMDTRMTPPGLDKLPEAVERHTGSLNDEWLMAADLIVASP--
2nacA1          MHVGTVAAGRIGLAVLRRLAPFDV---HLHYTDRHRLPESVEKELNLT-WHATREDMYPVCDVVTLNC--


                         .         .         *         .         .         .         .:140
query           IVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
1yqgA1          ----------------------------------------------------------------------
2ahrA2          QLFETVLKPLHFKQP-----IISXAAGISLQRLATFVG-QDLPLLRIXPNXNAQILQSSTALTGNALVSQ
1yqgA2          QDXEAACKNIR----TNGALVLSVAAGLSVGTLSRYLG-GTRRIVRVXPNTPGKIGLGVSGXYAEAEVSE
2ahrA1          ----------------------------------------------------------------------
1jaxA           EHAIDTARDLKNILREKIVVSPLVPVSRGAKGFTYSSERESEKVVSALHTIPAARFANLDEKFDWDVPDD
2i76A2          RYIKTVANHLNLGDAVLV--------HCSGFLSSEIFKKSGRASIHPNFSFLEKALEXKDQIVFGLEGDE
1ks9A2          DAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTHAARRDGNVIIHVANGITHIGPARQQDG
2f1kA2          QLILPTLEKLIPHL---SPTAIVTDVASVKTAIAEPASQLWSGFIGGHPXAGTAAQGAEENLFVNAPYDP
1vjpA1          IRKGVHLGSVRNLPIEAEGLEDSMTLKEAVDTLVKEWTELDPDVIVNTCTTEAFVFGNKEDLLKAIENND
1i36A2          ----------------------------------------------------------------------
1txgA2          DGVLPVMSRIDQYIVLISKGLIDFDNSVLTVPEAVWRLKHDLRERTTGPAIAREVAKRMPTTVVFSSPSE
1tltA1          ----------------------------------------------------------------------
1iukA           SALMDHLPEVLA----LRPGLVWLQSGIRHPEFEKAL--KEAGIPVVADRCLMVEHKRL-----------
1xeaA1          HAATDVHSTLAAFFLHLGIPTFVDKPLAASAQ-------ECENLYELAEKHHQPLYVGF-------NGFD
1qmgA2          SAQADNYEKVF-----------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
1yqgA1          -------------------DEEKXHGITGISGSGPAYVFYLLDALQNAAIRQGFDXAEARALSLATFKGA
2ahrA2          ELQARVRDLTDSFGSTFDISE-------------------------------------------------
1yqgA2          TDRRIADRIXKSVGLTVWLD--------------------------------------------------
2ahrA1          ---------------------KDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
1jaxA           ESKKVVMSLISEIDGLRPLDAGPLSNSRLVESLTPLILNIMRNGMGELGIK-------------------
2i76A2          RGLPIVKKIAEEISG-------------------------------------------------------
1ks9A2          DYSYLADILQTVLPDV------------------------------------------------------
2f1kA2          EQLAXLRSVLEPLGV-------------------------------------------------------
1vjpA1          KERLTATQVYAY----AAALYANKRGGAAFVNVIPTFI-ANDPAFVELAKENNL----------------
1i36A2          ----------------------------------------------------------------------
1txgA2          SSANKMKEIFETEYFGV-----------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1iukA           ----------------------------------------------------------------------
1xeaA1          AXVQDWLQVAAKLPTHIIER--------------------------------------------------
1qmgA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKxxx
1yqgA1          VALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRR---
2ahrA2          ------------------------------------------------------
1yqgA2          ------------------------------------------------------
2ahrA1          ASNLKTSSQSPHDFIDAICSPGGTTIAGLXELERLGLTATVSSAIDKTIDK---
1jaxA           ------------------------------------------------------
2i76A2          ------------------------------------------------------
1ks9A2          ------------------------------------------------------
2f1kA2          ------------------------------------------------------
1vjpA1          ------------------------------------------------------
1i36A2          ------------------------------------------------------
1txgA2          ------------------------------------------------------
1tltA1          ------------------------------------------------------
1iukA           ------------------------------------------------------
1xeaA1          ------------------------------------------------------
1qmgA2          ------------------------------------------------------
1e0dA1          ------------------------------------------------------
2nacA1          ------------------------------------------------------