[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00097.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "2pagA1.bssp"
#ERROR : Can't open dsspfile "1clqA2.bssp"
#ERROR : Can't open dsspfile "1mr5A1.bssp"
#ERROR : Can't open dsspfile "1clcA1.bssp"

## Summary of PDB Search
:807
      0.0  42%  1a8iA  [c.87.1.4] GLYCOGEN PHOSPHORYLASE B
    6e-25  13%  2pagA1 [d.369.1.1] HYPOTHETICAL PROTEIN A:1 -- 135
    1e-15   9%  1clqA2 [e.8.1.1] PROTEIN (DNA POLYMERASE) A:376 -- 903
    4e-04  14%  1mr5A1 [b.29.1.15] TRANS-SIALIDASE A:409 -- 633
    0.001  24%  1clcA1 [a.102.1.2] ENDOGLUCANASE CELD EC: 3.2.1.4 A:135 -- 575
:807

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
1a8iA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2pagA1          ----------------------------------------------------------------------
1clqA2          ----------------------------------------------------------------------
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
1a8iA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2pagA1          ----------------------------------------------------------------------
1clqA2          ----------------------------------------------------------------------
1mr5A1          -------------------------------------------PKGASPLLGASLDSSGGKGLSYDKR-H
1clcA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
1a8iA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2pagA1          ----------------------------------------------------------------------
1clqA2          ----------------------------------------------------------------------
1mr5A1          QWQPIYGSTPVTPTGSWE-MGKR----YHVVLTMANKIGSVYIDGEPLSGQTVVPDERTPDISHFYVGGY
1clcA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
1a8iA           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2pagA1          ----------------------------------------------------------------------
1clqA2          ----------------------------------------------------------------------
1mr5A1          KRSGMPTDSRVTVNNVLLYNRQLNAEE-------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
1a8iA           TLQDIIRRFKKFRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2pagA1          ----------------------------------------------------------------------
1clqA2          ---------------------------------SAKSLNEMLFRAQRTEVAGMTAQINRKLLINSLYGAL
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
1a8iA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFDVDRLRRMSLVEEKRINMAHLCIAGSHAVNGV
2pagA1          ----------------------------------------------------------------------
1clqA2          GNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
1a8iA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
2pagA1          ----------------------------------------------------------------------
1clqA2          FRDTNHWVDMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRYAEPKLKIMGLETQK
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
1a8iA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
2pagA1          ----------------------------------------------------------------------
1clqA2          SSTPKAVQKALKECIGEESLQEYFKEFEKEFRQSSANNIAKYDVGGFPGPKCPFHIRGILTYNRAIKGND
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
1a8iA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
2pagA1          ----------------------------------------------------------------------
1clqA2          APQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYVLLEKTFIKPLEGFTSAAKLD-
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN
1a8iA           QISTAGTEASGTGNMXFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
2pagA1          --------------------------------VEIEEQLFINIPFVFKEFLLTVSDVVYGS-LEPVTVTD
1clqA2          ----------------------------------------------------------------------
1mr5A1          ----------------------------------------------------------------------
1clcA1          -------------YNKYVVNAGITVGSMFLAWEHFKDQLEPVALEIP-----------------------


                         .         .         .         .         +         .         .:770
query           NHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLV
1a8iA           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
2pagA1          --PQSHTYLPEVCATAWD--LGVPRELIPICQDGEDYYCVEEDGTVLLWSALVTEESWESVWHWARDVWL
1clqA2          ----------------------------------------------------------------------
1mr5A1          ----------------------------------------------------------------------
1clcA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NIAYGGMFSSDDTIKRYAEDIWNISPLKxxxxxxxxx
1a8iA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
2pagA1          E------------------------------------
1clqA2          -------------------------------------
1mr5A1          -------------------------------------
1clcA1          -------------------------------------