[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00183.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vctA2.bssp"
#ERROR : Can't open dsspfile "1lnqA4.bssp"
#ERROR : Can't open dsspfile "1hkuA2.bssp"
#ERROR : Can't open dsspfile "1id1A.bssp"

## Summary of PDB Search
:618
    5e-09  17%  1vctA2 [d.286.1.1] HYPOTHETICAL PROTEIN PH0236 A:108 -- 201
    8e-07  23%  1lnqA4 [d.286.1.1] POTASSIUM CHANNEL RELATED PROTEIN A:245 -- 336
    3e-04  19%  1hkuA2 [c.23.12.1] C-TERMINAL BINDING PROTEIN 3 A:15 -- 114 A:308
    4e-04  17%  1id1A  [c.2.1.9] PUTATIVE POTASSIUM CHANNEL PROTEIN
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIIGVNLVTVSAAQQLS
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ----------------------------------------------------------------------
1id1A           ------------------------------------------------------VCGHSILAINTILQLN


                         .         .         +         .         .         .         .:490
query           KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKLSLAAKKYGVN
1vctA2          ----------------------------------------------------------------------
1lnqA4          ----------------------------------------------------------------------
1hkuA2          ---------------------VATVAFCDAQSTQEIHEKVLNEAVGALMYHTIT-LTREDLEKFKA---L
1id1A           QRGQNVTVISNLPEDDIKLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSD


                         *         .         .         .         .         +         .:560
query           RVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQILTSSESRLYEVVVNDSIFVGV
1vctA2          -------------------------------------------PVIKETILEGEEIIGKIQVPESVIVGK
1lnqA4          -----------------------------------------DGYEAMFVQDESTRRMVEVPIPGSKLEGV
1hkuA2          RIIVRIGSGFDNIDI-KSAGDLGI----------------------------------------------
1id1A           KTVLAVSD----SKNLNKIKMVHP--------------DIILSPQLFGSEILARVLNGEEINND------


                         .         .         .         *         .         .         .:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESAYFRRKLQRRxx
1vctA2          TLGELATNTGVWIIAVRRGKRWIGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGA--
1lnqA4          SVLDADDVTGVIIIGVGRDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYIS----
1hkuA2          ----------------------------------------------------------
1id1A           ----------------------------------------------------------