[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1iq4A.bssp"

## Summary of PDB Search
:180
    3e-72  82%  1iq4A  [d.77.1.1] 50S RIBOSOMAL PROTEIN L5
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
1iq4A           -MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQRPVVTR


                         .         .         *         .         .         .         .:140
query           AKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
1iq4A           AKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFRGVSKKSFDGRGNYTLGIKEQLIFP


                         +         .         .         .         .         *         .:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK
1iq4A           EIDYDKVNKVRGMDIVIVTTANTDEEARELLALLGMPFQK