[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00229.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s72K.bssp"

## Summary of PDB Search
:122
    1e-37  37%  1s72K  [b.39.1.1] 50S RIBOSOMAL PROTEIN L14P
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
1s72K           GLEKGSLITCADNTGARELKVISVHGYSGTKKAGLGDKITVSVTKGTPEMRRQVLEAVVV---RQRKPIR


                         .         .         *         .         .         .         .:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL
1s72K           RPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQ-RFGSVASAATMIV