[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00286.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "2apoA2.bssp"
#ERROR : Can't open dsspfile "1kskA4.bssp"
#ERROR : Can't open dsspfile "1ze2B2.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1k8wA5.bssp"
#ERROR : Can't open dsspfile "1s72A1.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"

## Summary of PDB Search
:296
    7e-52  33%  1v9kA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    4e-46  36%  1przA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    2e-32  17%  2apoA2 [d.265.1.2] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:17 --
    2e-27  21%  1kskA4 [d.265.1.3] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    2e-26  13%  1ze2B2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B B:1 -- 228
    1e-25  14%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    4e-25  15%  1k8wA5 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:9 -- 250
    7e-21   8%  1s72A1 [b.34.5.3] 50S RIBOSOMAL PROTEIN L2P A:91 -- 237
    4e-07  14%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    3e-04  11%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
:296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
1v9kA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
2apoA2          -------------------------------------------------------ELIVKEEVETNWDYG
1kskA4          ----------------------------------------------------------------------
1ze2B2          ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1k8wA5          ----------------------------------------------------------------------
1s72A1          ----------------------------------------------------------------------
1dm9A           ---------AVEVRLDKWLWAARYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVI
1fjgD           -------LGLLESRLDNVVYRLGAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLEL


                         .         .         *         .         .         .         .:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
1v9kA           --------IXYEDDHILVLNKPSGTAVHGGSGLSFGVIEGLRALRPEARF-----LELVHRLDRDTSGVL
1przA           ----IPLDIVYEDEDIIVINKPRDLVVHPGAGNPDGTVLNALL-HYYPPIADVPRAGIVHRLDKDTTGLX
2apoA2          CNPYERKIEDLIKYGVVVVDKPRGPTSHEVS--------TWVKKILNLDK-----AGHGGTLDPKVTGVL
1kskA4          ----------------FXLNKPQGYVCSTDDPDH-PTVLYFLDEPVAWK------LHAAGRLDIDTTGLV
1ze2B2          ------------KHGILVAYKPKGPTSHD--------VVDEVRKKLKTRK-----VGHGGTLDPFACGVL
1r3eA2          ------------KHGILVAYKPKGPTSHD--------VVDEVRKKLKTRK-----VGHGGTLDPFACGVL
1k8wA5          -----------DINGVLLLDKPQGMSSND--------ALQKVKRIYNANR-----AGHTGALDPLATGML
1s72A1          ------------------------------------------------------EGVPVCNVESSPGDGG
1dm9A           VKAITEQRRPASEAALLYEETAE-----------------------------------------------
1fjgD           IRQNLEAMKGRKVGPWLSLDVEGMKGKFLPDREDLALPVQ------------------------------


                         +         .         .         .         .         *         .:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
1v9kA           LVAKKRSALRSLHEQLREKGXQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
1przA           VVAKTVPAQTRLVESLQRREITREYEAVAIGHXTA-GGTVDEPISHPTKRTHXAVHPXGKPAVTHYRIXE
2apoA2          PVALERATK----TIPMWHIPPKEYVCLMHLHRDASEEDILRVFKEFTGRIYQR----RIRKIHELELLD
1kskA4          LXTDDGQWSHRI--TSPRHHCEKTYLVTLESPVADDTAEQFAK----------GVQLHNEKDLTKPAVLE
1ze2B2          IIGVNQGTRILE----FYKDLKKVYGEYDQVPPAYSAKKYKGERLYKLA--------------REGKIIN
1r3eA2          IIGVNQGTR----ILEFYKDLKKVYWVKMRLGLITETFDITPPAYSAKKYKGEKIINLPPKRVKIFKIWD
1k8wA5          PICLGEATK----FSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERPVTFSA----------------
1s72A1          KFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQGGGRTDKPFVKGNKHHKMKARGTKWPNVRGVAM--
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
1v9kA           RYAF-ATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDEAGTGLNRLFLHAAALKFTHPGTGEVXRIE
1przA           HFRV-HTRLRLRLETGRTHQIRVHXAHITHPLVGDPVYGRPRPPKFDRQALHATXLRLYHPISGIEXEWH
2apoA2          KDGK---DVLFRVKCQSGTYIRKLCEDIGEALGTSAHM-QELRRTKSGCFEEKDAVYLQDLLDAYVFWKE
1kskA4          VITPT--QVRLTISEGRYHQVKRXFAAVGNHVVELHRER-------------------------------
1ze2B2          LPPKRVKIFKIRVEVSPGTYIRVRESVGPHTIEESLNVFEAA-PEEIENRIIPLEK--------------
1r3eA2          VNIE-GRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAV-----ELVRESVGPHTIEESLNVFEAAPEEI
1k8wA5          ----EQLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYAQGIEVPREARPITVYELLFIRHEGNEELEIH
1s72A1          -------NAVDHPFGGGGRQHPG------KPKSISRNAPPGRKVGD-IASKRTGRG--------------
1dm9A           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SEMPKDLENLIVRLKN
1v9kA           APXDEGLKRCLQKXRN
1przA           APIPQDXVELI-----
2apoA2          DGDEEELRRVIKPME-
1kskA4          ----------------
1ze2B2          ----------------
1r3eA2          ENRIIPLEKCL-----
1k8wA5          CSKGTYIRTIIDDLGE
1s72A1          ----------------
1dm9A           ----------------
1fjgD           ----------------