[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00290.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1evqA.bssp"
#ERROR : Can't open dsspfile "1acjA.bssp"
#ERROR : Can't open dsspfile "1lzkA.bssp"
#ERROR : Can't open dsspfile "1ve6A2.bssp"
#ERROR : Can't open dsspfile "1gkkA.bssp"
#ERROR : Can't open dsspfile "1cleA.bssp"
#ERROR : Can't open dsspfile "1dqyA.bssp"
#ERROR : Can't open dsspfile "2pblA1.bssp"
#ERROR : Can't open dsspfile "1xfdA2.bssp"
#ERROR : Can't open dsspfile "1vkhA.bssp"
#ERROR : Can't open dsspfile "1auoA.bssp"
#ERROR : Can't open dsspfile "1ukcA.bssp"
#ERROR : Can't open dsspfile "2gzrA1.bssp"
#ERROR : Can't open dsspfile "1bcr.1.bssp"
#ERROR : Can't open dsspfile "1aknA.bssp"
#ERROR : Can't open dsspfile "2jbwA1.bssp"
#ERROR : Can't open dsspfile "2h1iA1.bssp"
#ERROR : Can't open dsspfile "1j2eA2.bssp"
#ERROR : Can't open dsspfile "1el5A2.bssp"
#ERROR : Can't open dsspfile "2i3dA1.bssp"
#ERROR : Can't open dsspfile "1l2qA.bssp"
#ERROR : Can't open dsspfile "2r8bA1.bssp"
#ERROR : Can't open dsspfile "1r1dA.bssp"
#ERROR : Can't open dsspfile "2b20A2.bssp"
#ERROR : Can't open dsspfile "3b5eA1.bssp"
#ERROR : Can't open dsspfile "1dinA.bssp"
#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "1hlgA.bssp"
#ERROR : Can't open dsspfile "1fj2A.bssp"
#ERROR : Can't open dsspfile "1ivyA.bssp"
#ERROR : Can't open dsspfile "2fukA1.bssp"
#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "1ufoA.bssp"
#ERROR : Can't open dsspfile "1iunA.bssp"
#ERROR : Can't open dsspfile "1e5tA2.bssp"

## Summary of PDB Search
:273
    3e-19  22%  1evqA  [c.69.1.2] SERINE HYDROLASE
    8e-17  11%  1acjA  [c.69.1.1] ACETYLCHOLINESTERASE
    6e-15  16%  1lzkA  [c.69.1.2] HEROIN ESTERASE
    5e-13  22%  1ve6A2 [c.69.1.33] ACYLAMINO-ACID-RELEASING ENZYME A:322 -- 581
    2e-12  10%  1gkkA  [c.69.1.2] ENDO-1,4-BETA-XYLANASE Y
    4e-12  10%  1cleA  [c.69.1.17] CHOLESTEROL ESTERASE
    3e-11  10%  1dqyA  [c.69.1.3] PROTEIN (ANTIGEN 85-C)
    2e-10  26%  2pblA1 [c.69.1.2] PUTATIVE ESTERASE/LIPASE/THIOESTERASE A:1 -- 261
    2e-10  19%  1xfdA2 [c.69.1.24] DIPEPTIDYL AMINOPEPTIDASE-LIKE PROTEIN 6 A:592
    5e-10  16%  1vkhA  [c.69.1.32] PUTATIVE SERINE HYDROLASE
    8e-10  12%  1auoA  [c.69.1.14] CARBOXYLESTERASE
    2e-09  19%  1ukcA  [c.69.1.17] ESTA
    9e-09  11%  2gzrA1 [c.69.1.38] IROE PROTEIN A:41 -- 305
    4e-08  10%  1bcr.1 [c.69.1.5] SERINE CARBOXYPEPTIDASE II A:- -- - B:- -- -
    7e-08   8%  1aknA  [c.69.1.1] BILE-SALT ACTIVATED LIPASE
    1e-07  12%  2jbwA1 [c.69.1.41] 2,6-DIHYDROXY-PSEUDO-OXYNICOTINE HYDROLASE A:8
    3e-07  25%  2h1iA1 [c.69.1.14] CARBOXYLESTERASE A:1 -- 202
    9e-07  14%  1j2eA2 [c.69.1.24] DIPEPTIDYL PEPTIDASE IV A:509 -- 766
    2e-06  10%  1el5A2 [d.16.1.3] SARCOSINE OXIDASE A:218 -- 321
    2e-06  10%  2i3dA1 [c.69.1.36] HYPOTHETICAL PROTEIN ATU1826 A:2 -- 219
    5e-06  14%  1l2qA  [c.1.25.1] MONOMETHYLAMINE METHYLTRANSFERASE
    1e-05  20%  2r8bA1 [c.69.1.14] UNCHARACTERIZED PROTEIN ATU2452 A:44 -- 246
    4e-05  14%  1r1dA  [c.69.1.29] CARBOXYLESTERASE
    1e-04  19%  2b20A2 [c.69.1.2] ENTEROCHELIN ESTERASE A:151 -- 397
    1e-04  14%  3b5eA1 [c.69.1.14] MLL8374 PROTEIN A:7 -- 215
    1e-04  17%  1dinA  [c.69.1.9] DIENELACTONE HYDROLASE
    1e-04  37%  1a7uA  [c.69.1.12] CHLOROPEROXIDASE T
    2e-04  13%  1hlgA  [c.69.1.6] LIPASE, GASTRIC
    2e-04  18%  1fj2A  [c.69.1.14] PROTEIN (ACYL PROTEIN THIOESTERASE 1)
    3e-04  11%  1ivyA  [c.69.1.5] HUMAN PROTECTIVE PROTEIN
    4e-04  13%  2fukA1 [c.69.1.36] XC6422 PROTEIN A:3 -- 220
    6e-04  29%  1c4xA  [c.69.1.10] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    8e-04  18%  1ufoA  [c.69.1.27] HYPOTHETICAL PROTEIN TT1662
    8e-04  30%  1iunA  [c.69.1.10] META-CLEAVAGE PRODUCT HYDROLASE
    0.001  21%  1e5tA2 [c.69.1.4] PROLYL ENDOPEPTIDASE A:431 -- 710
:273

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQKITEKITVAGHTAELMGYTIEKKNDWGVQDKHATIIICPGGGYHFVSDREADPVALKLITMGYNAFVL
1evqA           --------DLPGRTLKVRXYRPE-----GVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFV
1acjA           -------------------LYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
1lzkA           ---------------------------------VPVLLWIHGGGFAIGTAESSDPFCVEVAREGFAVANV
1ve6A2          ------------------------------------------GGPFAEDSDSWDTFAASLAAAGFHVVMP
1gkkA           ------TYTGINGTKSLNVYLPYGYDPNK---KYNIFYLXHGGGENENTIFSNDVKLQNILDHAIXNGEL
1cleA           --------------------------------NLPVMLWIFGGGFEIGSPPAQMVTKSVLMGKPIIHVAV
1dqyA           --------------------------------GPHAVYLLDGLRAQDDYWDINTPAFEEYYQSGLSVIMP
2pblA1          -----------------------------------LFVFVHGGYWXAFDKSSWSHLAVGALSKGWAVAXP
1xfdA2          --------------------------------HYPLLLVVDGTGSQSVAEKEVSWETVMVSSHGAVVVKC
1vkhA           ------------------------------QNTREAVIYIHGGAWNDPENQLANTIKSXDTESTVCQYSI
1auoA           --------------------------------ADACVIWLHGLGADR---YDFMPVAEALQESLLTTRFV
1ukcA           ------------------------------QSKLPVWLFIQGGGYAENSNANYNGTQVIQASDDVIVFVT
2gzrA1          FSATSFDSVDGTRH---YRVWTAVPNTTAPASGYPILYXLDGNA--VXDRLDDELLKQLSEKTPPVIVAV
1bcr.1          ---------------------------GPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFL
1aknA           --------------------------------------------------------------VGPLGFLS
2jbwA1          --------------------------------PHPAVIXLGGLESTK---EESFQXENLVLDRGXATATF
2h1iA1          ----------------------------------------------------------------------
1j2eA2          ---------------------------------------------------------------GSGYQGD
1el5A2          -------------------------------DIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKID
2i3dA1          --------------------------------SAPIAIILHPHPQFGGTXNNQYQLFYLFQKRGFTTLRF
1l2qA           --------------------------------------------------------------MMEKLFKA
2r8bA1          ----------------------------------------------------------------------
1r1dA           -----------------------------------AVLLLHGFTGNS---ADVRXLGRFLESKGYTCHAP
2b20A2          ----------------------------------------------------------------------
3b5eA1          --------------------------------SRECLFLLHGSGVDETTLVPLAR----RIAPTATLVAA
1dinA           ------------------------------------IVIAQEIFGVN---AFMRETVSWLVDQGYAAVCP
1a7uA           ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
1fj2A           ----------------------------------------------------------------------
1ivyA           ---------------------------------------------------------------SYSDDKF
2fukA1          -------LDGPVGPLDVAVDLPEPDVA----VQPVTAIVCHPLSTEGGSMHNKTMAARALRELGITVVRF
1c4xA           ----------------------------------------------------------------------
1ufoA           ----------------------------------------------------------------------
1iunA           ----------------------------------------------------------------------
1e5tA2          ----TVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLY-GYGGFNISITPNYSVSRLIFVRMGGVLAVA


                         .         .         *         .         .         .         .:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
1evqA           DYRLEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGG---------P
1acjA           LSYRVAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGS
1lzkA           EYRLETTFPGPVNDCYAALLYIHAHAEELGIDPSRIAVGGQSAGGGLAAGTVLKARDEGVVPVAELDDRL
1ve6A2          NYRGSTGYGEELEDVSAAARWARESGLA-----SELYIMGYSYGGYMTLCALTMKP--GLFKAG-----V
1gkkA           EPGNCTAQNFYQEFRQNVIPFVESKYSTYAES-TTPQGIAASRXHRGFGGFXXG---------GLTTWYV
1cleA           NYRVASWGNAGLKDQRLGMQWVADNIAGFGGDPSKVTIFGESAGSMSVL-----CHLIWNDGDNTYKGKP
1dqyA           VGQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYP----QQFPYAAS-L
2pblA1          SYELEVRISEITQQISQAVTAAAKEID------GPIVLAGHSAGGHLVA---------------------
1xfdA2          DGLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYI--------LPAKGENQGQT
1vkhA           EYRLEITNPRNLYDAVSNITRLVKEKGL-----TNINXVGHSVGATFIWQILAA-----LKDPQEKXSEA
1auoA           LPQAPTRPVTINGGYEMPSWYDIKMSPARSISLEELEVSAKMVTDLIEAQKRTGIDA-------------
1ukcA           FNYRNGDLNAGLLDQRKALRWVKQYIEQFGGDPDHIVIHGVSAGAGSVAYHLSAYGG--------KDEGL
2gzrA1          GYQTNLPFDLNSRAYLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVL---DSWLSSSYFRSYYSAS--
1bcr.1          DSIYTSGDNRTAHDSYAFLAKWFERFPHYKY--RDFYIAGESYAGHYVPELS-------QLVHRSKNPVI
1aknA           TGDSNLPGNYGLWDQHMAIAWVKRNIEAFGGDPDNITLFGESAGGASVSLQTLSPYNKGLIKRAISQSGV
2jbwA1          DGPGQGEXFEYKRIAGDYEKYTSAVVDLLTKLEDAIGVLGRSLGGNYALKS--------AACEPRLAACI
2h1iA1          --------------------FLDEAAKEYKFDRNNIVAIGYSNGANIAASLL-------------FHYEN
1j2eA2          KIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAV-----
1el5A2          PDTINREFGVYPEDESNLRAFLEEYMPGANGELKRGAVCMYT----------------------------
2i3dA1          NFRSIGRSQGEGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIG-----------XQLLXRRPEIE
1l2qA           GFEMLLECGIYCTDTHRIVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRSVGDKAKPIVQGG------
2r8bA1          ---------------GKXADFIKANREHYQAG--PVIGLGFSNGANILANVLIE-----------QPELF
1r1dA           IYKGHGVPPEELVHTDWWQDVXNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIAPXYIKSEET
2b20A2          ---------------------------------DRTVVAGQSFGGLSALYAGLHWP------------ER
3b5eA1          RGEDGFRWFERIDPTRFEQKSILEAAKRHGLNLDHATFLGYSNGANLVSSLXLLH-----------PGIV
1dinA           DLYARQAPGQDERQREQAYKLWQAFDME---AGVGDLEAAIRYARHQPYSNG------KVGLVGYXL---
1a7uA           ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
1fj2A           -----------IKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALT----------------
1ivyA           YATNDTEVAQSNFEALQDFFRLFPEYKN-----NKLFLTGESYAGIYIPTLAVLVMQDPSM---------
2fukA1          NFRSTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGAYVSLRA-------------------
1c4xA           ----------------------------------------------------------------------
1ufoA           ----------------------------------------------------------------------
1iunA           ----------------------------------------------------------------------
1e5tA2          NIRGGGEYGETWHKLANKQNCFDDCAAEYLIKEKRLTINGGSNGGLLVATCANQ----------------


                         +         .         .         .         .         *         .:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
1evqA           ALAFQLLIYPSTGYDPAHPPASIEENAEGLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYD--PLRDV
1acjA           PNCPWASVSVAEGRR-RAVELGRNLNCNLNSDEELIHCLREKKPQELIPFDSIFRFSFVPVIDGEFFPTS
1lzkA           ETVSXTNFVDTPLWHRPNAILSWKYYLGESYSGPEDPDVSIYAAPSRATDLTGLPPTYLSTXELDPLRDE
1ve6A2          AGASVVDWEEMYELS-DAAFRNFIEQLTG----GSREIMRSRSPINHVDRIKEPLALIHPQNDSRTPLKP
1gkkA           XVNCLDYVAYFXPLSGDYWYGNSPQDKANSIAEAINRSGLSKREYFVFAATGSEDIAYANXNPQIEAXKA
1cleA           LFRAGIMQSGAMVPSSSAGCGSASDKLACLRSASSDTLLDATNNTPGFLAYSSLRLSYLPRPDGKNITDD
1dqyA           SGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLLGGDNIPAKFLEGLTLRTN
2pblA1          ----------------------------------------------------------------------
1xfdA2          FTCGSALS-PI--TDFKLYASAFSERYLGLHG-LDNRAYEMTKVAHRVSALEEQQFLIHPTADEKIHFQH
1vkhA           QLQXLVFLLDGIYSLKELLYDCFTRLAFPDGXYEEEPSRVXPYVKKALSRFSIDXHLVHSYSDELLTLRQ
1auoA           SRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAM
1ukcA           FIGAIVESSFWPTQRTVSEMEFQFERFVNDTGCSSAECLREQDIATIQSSPLPDWYFLPVTDGSLVPDEL
2gzrA1          ---------PSLG----RGYDALLSRVTAVEPLQ------------------FCTKHLAIXEGSAGVLSK
1bcr.1          NLKGFMVGNGLIDDYHDYV---GTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQG
1aknA           GLCPWAIQQDPLFWAKRIAEKVGCPVDDTSKMAPRALTLAYKLPLGSTEYPKLHYLSFVPVIDGDFIPDD
2jbwA1          SWGGFSDLDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHDEVPLSFV
2h1iA1          ALKGAVLHHPXV-------------------------PRRGXQLANLAG---KSVFIAAGTNDPICSSAE
1j2eA2          --------APVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQ
1el5A2          ----------------------------------------------------------------------
2i3dA1          GFXSIAPQPNTYDFSFLAPCP-------------------------------SSGLIINGDADKVAPEKD
1l2qA           ----------------------------------------------------------------------
2r8bA1          D--AAVLXHPLIP-------------------FEPKISPAKP---------TRRVLITAGERDPICPVQL
1r1dA           XYEGVLEYAREYKKREGKSEEQIEQEXERFKQTPXKTLKALQELIADVRAHLDLVYAPTFVHDEXINPDS
2b20A2          FGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEG---------------LRIVLEAGIREPXIXRAN
3b5eA1          RLAALLRPXPVL------------------------------DHVPATDLAGIRTLIIAGAADETYGPF-
1dinA           ---GGALAFLVAA-------KGYVDRAVGYYGVGL------EKQLNKVPEVKHPALFHMGGQDHFVPAPS
1a7uA           -----------------------------------------------------PALILHGTGDRTLPIEN
1hlgA           -----------------------------------------------------PIAVWNGGKDLLADPQD
1fj2A           -------------------TQQKLAGVTALSCWLPLRASFPQGPIGGANRDI-SILQCHGDCDPLVPLMF
1ivyA           NLQGLAVGNGLSSYEQNDNSLVYFAYLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNS
2fukA1          ----------------------------------------------------------------------
1c4xA           -----------------------------------------------------DVLVFHGRQDRIVPLDT
1ufoA           ---LLLAEGFRPRGVLAFIGSGFPXKLPQGQVVEDPGVLALYQAPPATRGEAYPLLHLHGSRDHIVPLAR
1iunA           -----------------------------------------------------ETLIIHGREDQVVPLSS
1e5tA2          RPDCVIAQVGVMYTIGHAWDYGCSDSKQHFEWLIKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLH


                         .         .         .         +         .         .         .:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRPEDIEPQAAQWVDLFHSWMQALLK
1evqA           GKLYAEALNKAGVKVEIENFEDLIHGFAQFY----------SLSPGATKALVRIAEKLRDAL-
1acjA           LESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPH-----
1lzkA           GIEYALRLLQAGVSVELHSFPGTFHGSALV-----------ATAAVSERGAAEALTAIRRGLR
1ve6A2          LLRLMGELLARGKTFEAHIIPDAGHAI------------------------------------
1gkkA           LPHFDYTSDFSKGNFYFLVAPGATHWWGYVRHYIYD---------------------------
1cleA           MYKLVRDGKYASVPVIIGDQNDEGTVFGLSSLNVTTNAQARAYFKQSFIHASDAEIDTL----
1dqyA           QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAM--------------------------
2pblA1          ---------------------------------------------------------------
1xfdA2          TAELITQLIRGKANYSLQIYPDESHYFT-----------------------------------
1vkhA           TNCLISCLQDYQLSFKLYLDDLGLHNDVYKNGKVAK---------------------------
1auoA           GRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGA---------------------------
1ukcA           YNAFDAG--------------------------------------------------------
2gzrA1          IHTTLTILKDKGVNAVFWDFPNLGHG-------------------------------------
1bcr.1          NIDMYSLYTPVCNSYDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTH-----
1aknA           PVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSNKQDVTEEDFYKLVSGLTVTKGLRGA--
2jbwA1          DTVLE-LVPAEHL--NLVVEKDGDHCCHNLGIRYDVLVAGKKVAPTXKGW-------------
2h1iA1          SEELKVLLENANANVTXHWENRG-HQLTXGEVEKAK---------------------------
1j2eA2          SAQISKALVDVGVDFQAMWYTDEDHGIA-----------------------------------
1el5A2          ---------------------------------------------------------------
2i3dA1          VNGLVEKLKTQGILITHRTLPGANHFFNGKVDELXG---------------------------
1l2qA           ---------------------------------------------------------------
2r8bA1          TKALEESLKAQGGTVETVWHPGG-HEIRSGEIDAVR---------------------------
1r1dA           ANIIYNEIESPVK--QIKWYEQSGHVIT--------------LDQEKDQLHEDIYAFLESL--
2b20A2          QAL-YAQLHPIKESIFWRQVDGG----------------------------------------
3b5eA1          VPALVTLLSRHGAEVDARIIP-SGHDIGDPDAAIVR---------------------------
1dinA           RQLITEGFG-ANPLLQVHWYEEAGHSFARTSSGYVASAA-ALANERTLDFLA-----------
1a7uA           TRVFHKALPSA----EYVEVEGAPHGLLWTHAE------------------------------
1hlgA           VGLLLPKLPNL---IYHKEIPFYNHLDFIWAMD-----APQEVYNDIVSMIS-----------
1fj2A           GSLTVEKLKTNPANVTFKTYEGMMH--SSCQQEMMDVKQ------------------------
1ivyA           GLNIYNLYAPCAGGVPSHFRYEKDT--------------------------------------
2fukA1          ---------------------------------------------------------------
1c4xA           SLYLTKHLKHA----ELVVLDRCGH--------------------------------------
1ufoA           XEKTLEALRPHYPEGRLARFVEEGAG-------------------------------------
1iunA           SLRLGELIDRA----QLHVFGRCGHWTQI--EQTDRFNR------------------------
1e5tA2          SLKFIATLRKQNNPLLIHVDTKAGHG-------------------------------------