[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00302.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bq3A.bssp"
#ERROR : Can't open dsspfile "1ebbA.bssp"
#ERROR : Can't open dsspfile "1dklA.bssp"
#ERROR : Can't open dsspfile "1bifA2.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1qfxA.bssp"
#ERROR : Can't open dsspfile "2i1sA1.bssp"
#ERROR : Can't open dsspfile "1nt4A.bssp"
#ERROR : Can't open dsspfile "1ihpA.bssp"

## Summary of PDB Search
:228
    2e-76  53%  1bq3A  [c.60.1.1] PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
    2e-36  26%  1ebbA  [c.60.1.1] PHOSPHATASE
    4e-36   9%  1dklA  [c.60.1.2] PHYTASE
    9e-36  25%  1bifA2 [c.60.1.4] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:250 --
    6e-31  27%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-29  12%  1qfxA  [c.60.1.2] PROTEIN (PH 2.5 ACID PHOSPHATASE)
    5e-28  18%  2i1sA1 [d.343.1.1] HYPOTHETICAL PROTEIN A:4 -- 188
    1e-25  14%  1nt4A  [c.60.1.2] GLUCOSE-1-PHOSPHATASE
    1e-23  11%  1ihpA  [c.60.1.2] PHYTASE
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
1bq3A           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
1ebbA           --TLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLE--AVELAAIYTSTSGRALET---AEI
1dklA           --VVIVSRHGVRAPTKATQLMQDVTPDLTPRGGELIAYLGHYQRQRLVADGLLIADVDERTRKTGEAFAA
1bifA2          ---IYLCRHGESELNLKGRIGG--DPGLSPRGREFSKHLAQFISDQNIKDLKVFTSQMKRTIQTAEA---
1v37A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALP-----SLPAFSSDLLRARRTAEL---
1qfxA           -GDLAFLDWTYYVPNECYYNAE--TTSGPYAGLLDAYNHGNDYKARYGHLVPFFSSGYGRVIETARKFGE
2i1sA1          -----------------------------------------------------------KVYHLKLSIKG
1nt4A           --VLMMSRANLRSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAETVYAYANSLQRTVATAQFFIT
1ihpA           ---QVLSRHGARYQQNATTFDGLGADDLTPFGEQELVNSGIKFYQTRNIVPFIRSSGSSRVIASGKKFIE


                         .         .         *         .         .         .         .:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
1bq3A           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
1ebbA           VRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAP-------------------
1dklA           GLAPDCAITVH-TQADTSSPDPLFNPLKTGVCQLDNANVTDAILSRAGGSIADFTGHRQTAFRELERVLN
1bifA2          ----LSVPYEQFKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYP------------------
1v37A           ----AGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHP-----------------------
1qfxA           GFFGYNYSTNSEVMGADSLTPTCDTTTCDNLTYQLPQFKVAAARLNSQNPGMNLTASDVYNLMVMASFEL
2i1sA1          ITPQIWIQVPENYTFLDLHKAIQ-------AVMDWEDYHLHEFEMVNPKTGMLDKIGAEGDPLVSEKKAK
1nt4A           G----AFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKD
1ihpA           GFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLEN


                         +         .         .         .         .         *         .:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
1bq3A           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
1ebbA           ------QRGERFCDVQQRALEAVQSIVDRH--EGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGT
1dklA           FPQSN----LCLKRSCSLTQALPSELKVSADNVSLTGAVSLASMLTEFLLQQAQGMPEPGWGRITDSHQW
1bifA2          -------KGESYEDLVQRLEPVIME-----LERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHT
1v37A           ------PGGESLSAFQERVFRFLEGL-------KAPAVLFTHGGVVRAVLRALGLVPPGSAVAVDWPRRV
1qfxA           NARPFSNWINAFTQDEWVSFGYVEDLNYYYCAGPGDKNMAAVGAVANASLTLLNQGPKEAGSLFFNFAHD
2i1sA1          LSDYFTLENKEVKVRLEKILPRKEGVEYPICTAGKRAAVPEDSGGVWGYEEMLEVLKDSEH-----EEYE
1nt4A           SPACKEKQQCSLVDGKNTFSAKYQQE--------------------------------------------
1ihpA           ---DLSGVTLTDTEVTYLMDMCSFDTISTTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNLGPTQGV


                         .         .         .         +         .         .         .:280
query           PVVYDLDDKLNIVNKEKx
1bq3A           PLVFELDENLKPS-----
1ebbA           SVIIEVDGG---------
1dklA           NTLLSLHN----------
1bifA2          VLKLTPVAYGCKV-----
1v37A           LVRLALD-----------
1qfxA           TNITPILAALGVLIPNE-
2i1sA1          DTVLWLGDDFDPE-----
1nt4A           ------------------
1ihpA           GYANELIARLT-------