[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00312.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ooiA1.bssp"
#ERROR : Can't open dsspfile "3cnvA1.bssp"
#ERROR : Can't open dsspfile "2ikkA1.bssp"
#ERROR : Can't open dsspfile "2oggA1.bssp"
#ERROR : Can't open dsspfile "2fa1A1.bssp"
#ERROR : Can't open dsspfile "3bwgA2.bssp"
#ERROR : Can't open dsspfile "2p19A1.bssp"
#ERROR : Can't open dsspfile "2pkhA1.bssp"
#ERROR : Can't open dsspfile "2nwiA1.bssp"
#ERROR : Can't open dsspfile "3ddvA1.bssp"
#ERROR : Can't open dsspfile "1e2xA1.bssp"
#ERROR : Can't open dsspfile "3bwgA1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "1omiA2.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "1stzA1.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1ucrA.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "1jhfA1.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2co5A1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "1h3dA2.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "1i1gA1.bssp"
#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "2hoeA1.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"

## Summary of PDB Search
:241
    8e-31  26%  2ooiA1 [d.190.1.2] SA0254 PROTEIN A:73 -- 233
    2e-30  18%  3cnvA1 [d.190.1.2] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    5e-30  16%  2ikkA1 [d.190.1.2] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YURK A:86
    3e-29  28%  2oggA1 [d.190.1.2] TREHALOSE OPERON TRANSCRIPTIONAL REPRESSOR A:95
    4e-29  15%  2fa1A1 [d.190.1.2] PROBABLE TRANSCRIPTIONAL REGULATOR PHNF A:84 --
    2e-28  25%  3bwgA2 [d.190.1.2] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:89 --
    3e-26  21%  2p19A1 [d.190.1.2] TRANSCRIPTIONAL REGULATOR A:2 -- 149
    6e-26  13%  2pkhA1 [d.190.1.2] HISTIDINE UTILIZATION REPRESSOR A:109 -- 249
    5e-25  17%  2nwiA1 [d.190.1.3] HYPOTHETICAL PROTEIN A:1 -- 160
    4e-23  23%  3ddvA1 [d.190.1.2] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY) A:3 --
    7e-15  25%  1e2xA1 [a.4.5.6] FATTY ACID METABOLISM REGULATOR PROTEIN A:6 --
    2e-13  31%  3bwgA1 [a.4.5.6] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:5 --
    9e-13  23%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    1e-11  24%  1omiA2 [a.4.5.4] LISTERIOLYSIN REGULATORY PROTEIN A:1138 -- 1237
    2e-11  24%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    3e-11  15%  1stzA1 [a.4.5.51] HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA
    3e-11  16%  1aoyA  [a.4.5.3] ARGININE REPRESSOR
    1e-10  11%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    2e-10  14%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152
    4e-10  17%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    8e-10  13%  1ucrA  [a.4.5.45] PROTEIN DSVD
    1e-09  18%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    3e-09  16%  1xd7A  [a.4.5.55] YWNA
    3e-09  15%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    3e-09  16%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    7e-09  18%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    9e-09  16%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    9e-09  15%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    3e-08  17%  1jhfA1 [a.4.5.2] LEXA REPRESSOR A:2 -- 72
    3e-08  15%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    6e-08  20%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    9e-08  10%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
    1e-07  15%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    1e-07  20%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    3e-07  16%  1sfuA  [a.4.5.19] 34L PROTEIN
    4e-07  13%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    2e-06  10%  2co5A1 [a.4.5.48] VIRAL PROTEIN F93 A:5 -- 93
    2e-05  15%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    5e-05  18%  1h3dA2 [d.58.5.3] ATP-PHOSPHORIBOSYLTRANSFERASE A:225 -- 299
    6e-05  12%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    6e-05   7%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    1e-04  12%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    4e-04  29%  1i1gA1 [a.4.5.32] TRANSCRIPTIONAL REGULATOR LRPA A:2 -- 61
    4e-04  16%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    4e-04  13%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    6e-04  20%  2hoeA1 [a.4.5.63] N-ACETYLGLUCOSAMINE KINASE A:10 -- 71
    0.001  23%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
2ooiA1          ----------------------------------------------------------------------
3cnvA1          ----------------------------------------------------------------------
2ikkA1          ----------------------------------------------------------------------
2oggA1          ----------------------------------------------------------------------
2fa1A1          ----------------------------------------------------------------------
3bwgA2          ----------------------------------------------------------------------
2p19A1          ----------------------------------------------------------------------
2pkhA1          ----------------------------------------------------------------------
2nwiA1          ----------------------------------------------------------------------
3ddvA1          ----------------------------------------------------------------------
1e2xA1          -----AGFAEEYIIESIWNNRFPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNF
3bwgA1          --------IATEIETYIEEHQLQQDKLPVLETLXAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKH
1v4rA1          ----GYADVATHFRTLIKSGELAPDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKN
1omiA2          -----------------------ETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLD
2h6bA1          ----LFYELCSSQGKRVGDTYEITMPLS-QKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLG
1stzA1          -----LNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTD
1aoyA           -----QEELVKAFKALLKEEKFSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPA-
2cohA1          LKNRXAAALLELSETPLAHEEEGVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKIQLLDLK
2gauA1          ----LAETLLILKENFGFENDGATLIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKIIDCD
1zybA1          ----LKSKIIRFFLSHCEKPQGKTFKVKXDD-LARCLDDTRLNISKTLNELQDNGLIELHRKEILIPDA-
1ucrA           ---------MEEAKQKVVDFLNSSGSKSKFNDFTDLFPMKQREVKKILTALVNDELEYWSSGSTTMYGLK
2hs5A1          ----RTTRVAGILRDAIIDGTFRPGARLSEPDICAALDVSRNTVREAFQILIEDRLVAHELNRGVFVRVP
1xd7A           ----------SRLAVAIHILSLSMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGAS---
1lvaA3          ------SETQKKLLKDLEDKYRVSWQPPSFKEVAGSFNLDPSELEELLHYLVREGVL-VKINDEFYW---
1qbjA           ----------QDQEQRILKFELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLW---
1ft9A1          ----IKQRIAGFFIDHANTTGRQTGVIVSVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRGHYTIPNL
1xcbA1          -----AAISRLITYLRILEELEAQVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTR----GVGYTV---
2fnaA1          -----------LNIXRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPL
1jhfA1          -----------EVFDLIRDHISQTGMPPTRAEIAQRLGFSPNAAEEHLKALARKGVIEIVSGASRGIRLL
1cgpA1          -----IAQTLLNLAKQPDAMTHPGMQIKTRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIV-----
2b0lA1          ----LSYSELEAIEHIFEELDGNE-GLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLKGTYIKVL
2g9wA1          ------------------------------EALSARRDLAYTTVXAVLQRLAKKNLVLQIRAHRYAPVHG
1oyiA           -----------SNAEIVCEAIKTIIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPR----
1q1hA           -----------------------------DEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRSGWF--I
1sfuA           --------IFSLVKKEVLSLNTND-YTT-AISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPP-----
2jn6A1          ------KTYSEEFKRDAVALYENSDGAS-LQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSEAE
2co5A1          -------------------------RLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKV---
2htjA1          --------------------------------IAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYW
1h3dA2          -----------------------GAERPTILPLAMHMVSSETLFWETMEKLKALGAS-------------
1p6rA           ---------------------------EVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFV---
1z05A1          --------IKQINAGRVYKLIDQKGPIS-RIDLSKESELAPASITKITRELIDAHLIHETTVQEAI----
1biaA1          -------------------------EFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYS---
1i1gA1          --------------------------------IAKKLGISETAVRKRVKALEEKGII---EGYTIKINP-
1mzbA           -----------------------------KALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGH----
1lvaA4          --------------------------------ARDALGSSRKYVLPLLEYLDQVKFTRRVGD--------
2hoeA1          --------------------------------LAEELGLTKTTVGEIAKIFLEKGIVVEEKDSPRPTKSL
1wi9A           --------------------------------LAFQMGLRTQDAINRIQDLLTEGTLTGVIDRGKFI---


                         .         .         *         .         .         .         .:140
query           YLKNESIxxxxxxxxxGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
2ooiA1          ----------------VFKTNGFSKSRMTSKVLVFKEMATPPKSVQDELQLNADDTVYYLERLRFVDDDV
3cnvA1          -------------------RFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQLSXNHXP
2ikkA1          --------------------------LYFQHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
2oggA1          -----------------------------KTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEH
2fa1A1          ----------------RFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVA
3bwgA2          --------------------------FNVTSKVIELDVRKPTPEAAENLNIGXDEDIYYVKRVRYINGQT
2p19A1          -------------------------NLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2pkhA1          ---------------------------RHTCKVXVLKEEAAGSERALALDXREGQRVFHSLIVHFENDIP
2nwiA1          ----------------------AVTQKKVEVETLEQKIIRADRELAELLEIDEGDEVNYRVVYLRANGEI
3ddvA1          --------------------------RVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
1e2xA1          ----------------------------------------------------------------------
3bwgA1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
1omiA2          YLK-------------------------------------------------------------------
2h6bA1          ELK-------------------------------------------------------------------
1stzA1          ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2gauA1          RLQ-------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1ucrA           GAGKQA----------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
2fnaA1          I---------------------------------------------------------------------
1jhfA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2g9wA1          ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
1q1hA           YYWKPNI---------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
2co5A1          ----------------------------------------------------------------------
2htjA1          FL--------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2hoeA1          KI--------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
2ooiA1          LCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQ
3cnvA1          TVIDDLWLPGTHFRGLTLELLTAPLYGLFESEFGVSXVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDR
2ikkA1          LTFEVTHYPLDLFPGIDTFIADGSXHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDK
2oggA1          VILDKDYFFRKHVPHLTKEICENSIYEYIEGELGLSISYAQKEIVAEPCTDEDRELLDLRGYDHXVVVRN
2fa1A1          LCLIDHYFADLTLWPTLQRFDSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRT
3bwgA2          LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIES
2p19A1          VAILENYLPPAFNDVSLDELEKGGLYDALRSR-GVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVER
2pkhA1          VQIEDRFVNAQVAPDYLKQDFLQTPYAYL--SQVAPLTEGEHVVEAILAEADECKLLQIDAGEPCLLIRR
2nwiA1          YAKAISFTPLKRLENSFREDLMRPIGKIMR-KHNIEARREIRWSRVEEADLALAKELGIADRRVISRNYN
3ddvA1          ICFEVASIPYSLVK-IGHSNQT---------------------ISAVQASEQIAEYLEIKRGDAILRVRQ
1e2xA1          ----------------------------------------------------------------------
3bwgA1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
1omiA2          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1stzA1          ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2gauA1          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1ucrA           ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1jhfA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2g9wA1          ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
2co5A1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2hoeA1          ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IFFLDNGTPFEFSQMRLHFKYLKFNTFINxx
2ooiA1          TFYTMTGKPFDSSDIVFHYRHAQF-------
3cnvA1          ISYTYGDRPXEVRRGLYLTDHYHY-------
2ikkA1          TAFTSNDQPIYCSLFLXHTNRVTF-------
2oggA1          YVFLEDTSLFQYTESRHRLDKFRFVDFAR--
2fa1A1          LNHRDESSPAEYSVSLTRADMIEF-------
3bwgA2          IFHLTNGQPFDYSKISYNYEQSQFVVQAN--
2p19A1          VALDNSGQVIELGS-----------------
2pkhA1          RTW-SGRQPVTAARLIHPGSRHRLEGRF---
2nwiA1          --IIHRGKVLINITEFFP-------------
3ddvA1          VSYFENGLPFEYVRTQYAGSRFEF-------
1e2xA1          -------------------------------
3bwgA1          -------------------------------
1v4rA1          -------------------------------
1omiA2          -------------------------------
2h6bA1          -------------------------------
1stzA1          -------------------------------
1aoyA           -------------------------------
2cohA1          -------------------------------
2gauA1          -------------------------------
1zybA1          -------------------------------
1ucrA           -------------------------------
2hs5A1          -------------------------------
1xd7A           -------------------------------
1lvaA3          -------------------------------
1qbjA           -------------------------------
1ft9A1          -------------------------------
1xcbA1          -------------------------------
2fnaA1          -------------------------------
1jhfA1          -------------------------------
1cgpA1          -------------------------------
2b0lA1          -------------------------------
2g9wA1          -------------------------------
1oyiA           -------------------------------
1q1hA           -------------------------------
1sfuA           -------------------------------
2jn6A1          -------------------------------
2co5A1          -------------------------------
2htjA1          -------------------------------
1h3dA2          -------------------------------
1p6rA           -------------------------------
1z05A1          -------------------------------
1biaA1          -------------------------------
1i1gA1          -------------------------------
1mzbA           -------------------------------
1lvaA4          -------------------------------
2hoeA1          -------------------------------
1wi9A           -------------------------------