[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00338.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lnsA2.bssp"
#ERROR : Can't open dsspfile "1lnsA3.bssp"
#ERROR : Can't open dsspfile "1mpxA1.bssp"
#ERROR : Can't open dsspfile "1bvp12.bssp"
#ERROR : Can't open dsspfile "1ju3A1.bssp"
#ERROR : Can't open dsspfile "1lnsA1.bssp"
#ERROR : Can't open dsspfile "1ve6A2.bssp"
#ERROR : Can't open dsspfile "1mpxA2.bssp"
#ERROR : Can't open dsspfile "1ji3A.bssp"

## Summary of PDB Search
:801
    5e-54  29%  1lnsA2 [b.18.1.13] X-PROLYL DIPEPTIDYL AMINOPETIDASE A:551 -- 763
    1e-25  39%  1lnsA3 [c.69.1.21] X-PROLYL DIPEPTIDYL AMINOPETIDASE A:146 -- 550
    8e-23  16%  1mpxA1 [b.18.1.13] ALPHA-AMINO ACID ESTER HYDROLASE A:405 -- 637
    2e-12   9%  1bvp12 [b.19.1.1] BLUETONGUE VIRUS COAT PROTEIN VP7 1:121 -- 254
    8e-10  16%  1ju3A1 [b.18.1.13] COCAINE ESTERASE A:352 -- 574
    2e-06  27%  1lnsA1 [a.40.2.1] X-PROLYL DIPEPTIDYL AMINOPETIDASE A:1 -- 145
    7e-06  19%  1ve6A2 [c.69.1.33] ACYLAMINO-ACID-RELEASING ENZYME A:322 -- 581
    8e-05  13%  1mpxA2 [c.69.1.21] ALPHA-AMINO ACID ESTER HYDROLASE A:24 -- 404
    1e-04  16%  1ji3A  [c.69.1.18] LIPASE
:801

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
1lnsA2          ----------------------------------------------------------------------
1lnsA3          ----------------------------------------------------------------------
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          MRFNHFSIVDKNFDEQLAELDQLGF---------RWSVFWDEKKILKDFLIQSPSDMTALQATAELDVIE
1ve6A2          ----------------------------------------------------------------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
1lnsA2          ----------------------------------------------------------------------
1lnsA3          ----------------------------------------------------------------------
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          FL--KSSIELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRK
1ve6A2          ----------------------------------------------------------------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGQNLLDILANRGYxxxxxxxxxTEPIFFNGKAQPVFDTNKLIHEVVYVESELDTDQDGKRDLLKVIITR
1lnsA2          ----------------------------------------------------------------------
1lnsA3          -----------------------NHYHFFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIR
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          TGMILVEHWVSEGL--------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PAMTDNGMKVPTIFTASPYYLGTNDASAEKMMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
1lnsA2          ----------------------------------------------------------------------
1lnsA3          PKSTE---KLPVVMTASPYHLGINDKANDLALHDMNVELEEKTSHEIHV----EQKLPQKLSAKAKELPI
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          -----------------------------------------------------------RAPTPGPTVVL
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
1lnsA2          ----------------------------------------------------------------------
1lnsA3          VDKAPYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSR
1mpxA1          ----------------------------------------------------------------------
1bvp12          ------------TFQPGRWFMRAAQAVTAVVCGPDMIQVS----------LNAGARGDVQ----------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          VHGGPFAEDSDSWDTFAASLAAAGFHVVMPN----YRGSTGYGEEWRLKIIGDPCGGEL----------E
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANKAIPAWWSNGKVAMTGKSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYREGGLVIAPGGFPGED
1lnsA2          ----------------------------------------------------------------------
1lnsA3          KKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENGLVRSPGGFPGED
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----QI-FQGRNDPMMIYLVWRIENFAMAQGNSQQTQAGVTVSVGGVDMRAIIAWDGQLHVHNPT----Q
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          DVSAAARWARESGELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYEL--------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
1lnsA2          ----------------------------------------------------------------------
1lnsA3          LDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQ
1mpxA1          ----------------------------------------------------------------------
1bvp12          QNAMVQIQ--------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          --------------------SDAAFRNFI-------EQLTGGSREIMRSRSPINHVDRIKEPLALIHPQN
1mpxA2          ---------------------------------------------QEQALDKVXARTPLKVPTXWLQGLW
1ji3A           ------------------------------------------AFSAVVCAPFLGSYRNPTLGIDSHWLEN


                         *         .         .         .         .         +         .:560
query           DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
1lnsA2          ----------------------------------------------------------------------
1lnsA3          DWNVTPEQAYNFWKALPEGHAKHAFLHRGA-HIYMNSWQSIDFSETINAYFVAKLLDRDLNLN--LPPVI
1mpxA1          ----------------------------------------------------------------------
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          DSRTPLKPLLRLMGELLARGKTFEAHIIPDAGHAINTMED------------------------------
1mpxA2          DQEDXWGAIHSYAAXEPRDKLNYLVXGPWRHSQVNFEGARQFRHDVLRPFFDQYLVDGAP--KADTPPVF
1ji3A           DGIVNTISMNGPKRGSNDRIVPYDGTLKKGNDMGTYNVDHLEIIG-------------------------


                         .         .         .         *         .         .         .:630
query           VQNNTKESTWETYSSWxSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
1lnsA2          -----------------ANTQIKLPLGKTAVS-------FAQFDNNYDDETFKKYSKDFNVFKKDLFEN-
1lnsA3          LQENSKDQVWTMMNDF------------------------------------------------------
1mpxA1          ---------------------KPLYLQAGKLSFQPGQAGFEEYVSDVPFVPRPVDFADRAXWTTWLVHDQ
1bvp12          ----------------------------------------------------------------------
1ju3A1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1mpxA2          IY-NTGENHWDRLKAW------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
1lnsA2          ----KANE-AVIDLELPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKVRVKDFKVLDRGR
1lnsA3          ----------------------------------------------------------------------
1mpxA1          RFVDGRPVLTFVTEPLTEPLQIAGAPDVHLQASTSGSDSDWVVKLIDVY--------PEEXASNPKXGGY
1bvp12          ----------------------------------------------------------------------
1ju3A1          -----DDVLCYSTEVLTDPVEVTGTVSARLFVSSSAVDTDFTAKLVDVF---------------------
1lnsA1          ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
1lnsA2          NFMLDDLVELPL-VESPYQLVTKGFTNLQNQ-SLLTVSDLKADEWFTIKFELQPTIYHLEKADKLRVILY
1lnsA3          ----------------------------------------------------------------------
1mpxA1          ELP-----------------VSLAIFRGRYRESFSTPKPLTSNQPLAFQFGLPTANHTFQPGHRVXVQVQ
1bvp12          ----------------------------------------------------------------------
1ju3A1          --PDGRAI-----------ALCDGIVRMRYRETLVNPTLIEAGEIYEVAIDMLATSNVFLPGHRIMVQVS
1lnsA1          ----------------------------------------------------------------------
1ve6A2          ----------------------------------------------------------------------
1mpxA2          ----------------------------------------------------------------------
1ji3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPIEx
1lnsA2          STDFEHTVRDNRKVTYEIDLSQSKLIIPIE-
1lnsA3          -------------------------------
1mpxA1          SSLFPLYDRNPQTYVPNIF------------
1bvp12          -------------------------------
1ju3A1          SSNFPKY------------------------
1lnsA1          -------------------------------
1ve6A2          -------------------------------
1mpxA2          -------------------------------
1ji3A           -------------------------------