[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00427.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"

## Summary of PDB Search
:248
    4e-52  37%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    2e-38  17%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-38  18%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-36  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-34  10%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    6e-33  19%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-32  16%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-32   9%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-32  20%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-30  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-27  25%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    4e-27   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    8e-27  13%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    9e-27  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    3e-26  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    2e-24   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-24   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    3e-24  21%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-24  14%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    5e-24   8%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    2e-22  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    4e-22  13%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    7e-22  13%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-21  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-21  17%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-21   9%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-21  14%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    7e-21   8%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    9e-21  23%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-21   9%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-20   8%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-20  10%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    3e-20   9%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    3e-20  10%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-20  11%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    5e-20   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    1e-19  10%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    1e-19   8%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-19  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-19  12%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    3e-19   8%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    3e-19  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    3e-19   8%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    3e-18  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    4e-18  17%  1t3wA  [a.236.1.1] DNA PRIMASE
    5e-18  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    7e-18  11%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    8e-18  12%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    1e-17  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    1e-17  11%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-17  12%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-17   7%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    4e-17  18%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-17  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    6e-17   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    6e-17  15%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    8e-17   8%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    8e-17  10%  1oa8A  [b.145.1.1] ATAXIN-1
    1e-16  10%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-16  12%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    2e-16  11%  1jbkA  [c.37.1.20] CLPB PROTEIN
    2e-16  14%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-16  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    3e-16  15%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    5e-16  14%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    7e-16  15%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    9e-16  11%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    9e-16  12%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-15   8%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-15   8%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-15  12%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-15  13%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    3e-15  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    4e-15   9%  1jb1A  [c.91.1.2] HPRK PROTEIN
    4e-15  10%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    4e-15   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    8e-15   6%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-14   8%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-14  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    2e-14  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-14   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    2e-14  14%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-14   8%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    6e-14  18%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    6e-14  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    6e-14  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-13   9%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    1e-13  13%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    1e-13   7%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    2e-13   7%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-13  10%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-13  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    3e-13  17%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-13  10%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    5e-13  10%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    6e-13  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    7e-13  10%  1sbxA  [a.6.1.4] SKI ONCOGENE
    2e-12   8%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-12   5%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    5e-12  10%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    8e-12  19%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    1e-11  15%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-11   9%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    2e-11  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    2e-11  13%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    7e-11   9%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    8e-11  19%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    8e-11   8%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-09   9%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-09  16%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    3e-09  15%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    5e-09   7%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    6e-09  10%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    6e-09  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-08  11%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    3e-08   8%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    4e-08  13%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-07  22%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    2e-07  11%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-07  11%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-07   6%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    3e-07  18%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    4e-07  10%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    1e-06  16%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    1e-05  18%  1g31A  [b.35.1.1] GP31
    2e-05  12%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    3e-05  12%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-05  13%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    3e-04   2%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    4e-04   3%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    6e-04  15%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNRDKDGQLKV
1sgwA           KLEIRDLSVGYDKP-VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNG--------
1q3hA           LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPA
1m3eA1          ---------------DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGL
1e69A           -MRLKKL--YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGP
1ex6A           --------------------------SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTP----
2yyeA2          ------------------------------ILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKRN
1l7vC           --------QDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLA-RXAGXTSGKGSIQFAG------QP
1nijA1          ---------------------------AVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFG------
1pf4A1          -VDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKL
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
2gk3A1          ----------------------------------------------------------------------
1mukA           ---MRARRHSYSSFSKLLEAYLLVK-----WRMCEAREPSVDRLPLCAGID-PLNSDPFLKMVSV-----
1qhlA           -GKFRSL--TLINWNGFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGLKAGVCYSM
1t06A           ---------------TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQE--------
2iqhA1          -EEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGAAV-----KG
1vplA           -VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPH
1bgxT2          --------------------------------------------RGMLPLFEPKGRVLLVD--------G
2gx8A1          -----------------THAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERV---EEVRIETI
1jjvA           -----------------------------VGLTGGIGSGKTTIANLFTDLGVPLV------DADVVAREV
1urjA           -----DPDRALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPD---FSRVI
1ohcA1          ----------------------------------------------------DPQDDVYLDITDRLCFAI
1c4oA1          --RYRGPSPKGDQPKAIAGLVEALRDGERFVLLGATGTGKTVTMAKVIEALGRPALVLAPN-----KILA
1xbtA1          ---------------------------QIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAK-----
1khbA1          ----------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQ
2axpA1          ------------------------------ILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNE-
1n25A           -------------------------------FKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFAID
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFEEPAELYHYG
1poiA           ---------------LKDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILR------QGITDLTGLGGAAG
1bmfA3          IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK--LYCIY
1f46A           -----------------------------------------IIMNVAAHHGSELNGE-------------
1jalA1          ---------------------------FKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRL
1zs3A1          -------------------------------------------------------------------KLM
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1rkbA           ------------------------------LLTGTPGVGKTTLGK--ELASKSGLKYINVGDLARE----
1i1qA           VDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGA---------
1dnpA2          ----------------------------------------------------------------------
1pv4A3          --LFENLTPLHALTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERP-
1dhyA1          ----------------------------------------------------------------------
1e6cA           --------------------------TEPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQ--HTSGM
1t3wA           ---------------------------------------KRTTXRILILVQNPELATLVPPLENLDENK-
1cr0A           ----ESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK-KVGLAMLEESVE
1kgdA           ---------------------------KTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHT--------
1s9hA           ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNE--------
3cddA1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l7lA           ----------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLI
1viaA           ---------------------------KNIVFIGFXGSGKSTLARALA-------KDLDLVFLDSDFKFN
1l3aA           ------------------------------------------------------TPKVFVGYSIYKGKAA
1afrA           ------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDLNTL
1atrA1          -----------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA
1mjgM           GIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPEG
1oa8A           ----------------------------------------------------------------------
1grqA           ---------------------------RMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGV--------DS
2ancF1          --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDV
1jbkA           -ERAEQGKLDIGRDEEIRRTIQVLQTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDM
2fggA1          ----------------------------------------------------------------------
1ffhA2          -----------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA--------
1fl9A           -IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQG------------IGHQGNVK
1ni3A1          -----------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKV
1zp6A1          ---------------------------NILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKH-
1es6A2          ----------------------------------------------------------------------
1ii8.1          ------------------------------------------------------RTERERVKKEIKDLEK
1ak2A1          ---------------------------VRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDML---RAMVA
1mi8A           RVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRL-------GRTIKATANHRFLTI
1t9hA2          ----------------------------------------------------------------------
2gtlM1          -TITAAHRKSFFPNRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVIC----DFNLG
2pa7A1          ----------------------------------------------------------------------
1jb1A           ---------------SXHGVLVDIYG-LGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTI
1gm5A1          ----------------------------------------------------------------------
1tmkA           ---------------------------KLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGL
2v3jA1          ----------------PPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXGRDISEARPD
1xl3C1          ----------------------------------------------------------------------
1ckvA           -AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGYNG
1g6oA           FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIE---------
1tljA           ------LVWEELREKALNKIYHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSGRITIVDAEM
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDG-DNIRF
1puoA2          ----------------------------------------------------------------------
1f2t.1          -LRIKDIKKDEFTKVGARDIDLIFEKDGTKYRIKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYN
1q3tA           ------------------------------AIDGPASSGKSTVAKIIAKFTYLDTGAMYRAATYMALKNQ
1udwA           ---------------------------FLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSE
2vgmA3          ----------------------------------------------------------------------
1g8yA           -HKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQL-------AAQIAGGPDLLEVGEL
1qhdA1          ----------DNSSEYIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPP--------G
1ovmA2          VIDSPDICWVGCANNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQ
1g8fA3          ---------------------------FSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTE
1lw7A2          ---------------------------KTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFV------
1d8jA           ----------------------------------------------------------------------
1e3mA2          -IRITEGRHPVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGPI
3cddA2          -LKAGGKITKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWV
1cd5A           -VSFKHVVTFNMEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKFMGGVG
1sbxA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1w1wA           -----------------RGVTKVFGESNFTSIIGPNGSGKSNMMDAISFVDLIYRGPQFYQKYKIDGKTV
1mkyA1          ------------------------------LIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKT--------
1b77A2          ----------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVEDSG
1yj5A2          -------------------------NPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTL---GSWQRC
1f8xA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j90A           ------------------------------LIEGNIGSGKTTYLNHFCLLTEPVEKWRNVNGVNLL----
1np6A           ---------------------------PLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRK
2vnuD1          RIRTRRAAELLDKRIVISITTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR---------------
1iioA           ----------------------------------------------------------------------
2gujA1          -----------------------------------VKKGSDPYFTLQAVLDDQSSGRGTERVTLYDVN--
2bsqE1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1yr6A1          -----------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYV-NLDTGVKEL
1esmA           LSRLLNFYISSNLRREQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLH
1e6vC           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1jqjA3          -------------NEKFRGVRLYVSENQLKITANNPEQEE----------------AEEILDVTYSGAEM
1e2hA           ------------------------------YIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR---VLGAS
1pgsA2          ----------------------TEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINN--------
1odfA           -------------------------------FSGPQGSGKSFTSIQIHLMEKYGGEKSIGYASIDDFY--
1l1oA           ---------------RINAGMLAQFIDKPVCFVGRLEKIHPTGK--MFILSDGEGKNGTIEL------ME
1tueA           ---LRYQQIEFITFLALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPL
1g31A           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ------------------------------TIDGPSGAGKGTLCKAMAEWHLLDSGAIYLALAALHHHVD
2je6I3          ------------------GIVIDIMPVKVPRVIGKNKSMYETLTSK--SIFVANNGRIWAFSEEI---LI
1xkpA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1p5zB           ------------------------------SIEGNIAAGKSTFVNIL-KQLCEDWEVVPEPVARWCNVQS


                         .         .         *         .         .         .         .:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
1b0uA           ADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAGKYPVH
1sgwA           ---VPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNK----NEIMDALESVEVLDLKKKLGE
1q3hA           ---------RVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVT
1ji0A           HVIN-----RXGIALVPEGRRIFPELTVYENLXGAYNRKDKEGIKRDLEWIFSLF--PRLKERLKQLGGT
1m3eA1          GLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTPTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSP
1e69A           VRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLGEGRLEISIRKPGRRDQKLSL
1ex6A           -----RAGEVNGKDYNFVSVDEFKSMIKNNEFIEWA-QFSGNYYGSTVASVKQVSKSGKTCILDIDMQGV
2yyeA2          LMLSLDATACTDVTGFGL-LGHAWNICKNSNIGARIFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYL
1l7vC           LEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQ------HDKTRTELLNDVAGALALDDKLGRSTNQ
1nijA1          EVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDN-----LDKGNIQFDRLVIECTGMADPGP
1pf4A1          TNLRRH--FALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTS
1e9rA           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRND-YDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2gk3A1          --------------VLFIGESWHIHXIHSKGYDSFTSS----KYEEGATWLLECLRKGGVHTVQIAFPES
1mukA           --GPMLQSTRKYFAQTLFMAKTVSGLDVNAIDALLRLRTLGADKK----ALTAQLLMVGLQESADALAGK
1qhlA           LDQRVVVGVRLQ-----QVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLN-ERQARVLPLNELKDKLEA
1t06A           LAEELYATGNYDAMYFAGIIADPKA-MSESDFDRWIDGAYFYM------LSDYVVAVTLSESIAQDVADK
2iqhA1          VGTMVM-ELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDIFLARSALI
1vplA           EVRKLI--------SYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVST
1bgxT2          HH------------LAYRTFHALKGLTTSRGEPVQAVYGFAKSLKEDGDAVIVVFDAKAPSFRHEAYGGY
2gx8A1          IPASLQRKIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQE----EMTLGQFAEHVKQSLDVKGAR
1jjvA           VAKDS--PLLSKIVEHFGAQILNRAALRERVFNHDEDKLW--------------LNNLLHPAIRERMKQK
1urjA           AEPFNANHRSIGEKFTYPLPFFNRPLNRLLFVVGPAAVALRSRNVDAVARADENHEGAALPADITFTAFA
1ohcA1          LYSR----PKSASNVHYFSNELEYE-NFYADF--GPLN-LAMVYRYCCKIN-KKLKSITMLRKK--IVHF
1c4oA1          AQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVA
1xbtA1          DTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFC----------EAMANAGKTVIVAALDGTFQRK
1khbA1          GH-------LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGWEGIDEPLASGVTITS
2axpA1          -------KLFEHFNKLADEDNVIIDRFVYSNLVYKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSV
1n25A           QFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKT
1g6hA           IVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGE
1poiA           GDWDMLIGKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAPVTLMQGSGLTDEWGI
1bmfA3          VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSK
1f46A           ----LLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMVPSYGD
1jalA1          -------DALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLD
1zs3A1          IDEKYAKELDKA--EIDHHKPTAGAMLVLSNLFIENIRLTQAGYAKSPVKCEYLREIAQREVEYFFKISD
1bs2A1          -----------------------------------------------------------TGPYLQYAHSR
1j1zA2          ---------SMDANLLHISYEGGVLEDPWAEPPKG-----MFRMTQDPEEAPDAPEYVEVEF-FEGDPVA
1mm8A           -------RAADWAKSVFSSAALGDARLVNVAAQLASGKSITISSEGSKAAQEGAYRFIRNPNV--SAEAI
2f9hA1          --QATVTEIGKHAIDDSEKXIILFGETATDTLKQHA-VIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGS
1rkbA           --EQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHRTDTNVLYERLETRGYNE
1i1qA           ------------VGYFTAHGDLDTCIVIRSALVENG-IATVQAGAGIVLDSVPQSEADETRNKA------
1dnpA2          -----------------THVWFRQDLRLHDNLAL------------AAACRNSSARVLALYIATPRQWAT
1pv4A3          -EEVTEXQRLVKGEVVASTFDEPASRHVQ---------VAEXVIEKAKRLVEHKKDVIIL------LDSI
1dhyA1          ------------------------------------------------YLGFAVKDVPAWDHFLTKSVGL
1e6cA           TVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTAEELALRLQASLQAHQR
1t3wA           ------------LPGLGLFRELVNTCLSQPGLTTG--QLLEHYRGTNNAATLEKLSXWDDIADKNIAEQT
1cr0A           ETAEDLI-------GLHNRVRLRQSDSLKREIIE-------------NGKFDQWFDELFGNDTFHLYDSF
1kgdA           ---------TRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVE
1s9hA           -NFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGG--SKVRVDQK---CKSSAQIDPTPVIVTSNTNMCA
3cddA1          ----------------------------------------KTKAGVSLILGDNVKAARGRFSWRQRFSKF
1bccF           ------IRKWYYNAAGFNKYGLMRDDTIYENDDVKEAI-RRLPENLYDDRMFRIKRALDLNMRQQILP--
2qgmA1          ---------------------------------------------SGQSVQKNIVK--SIQSQANPLKTI
1l7lA           -------CHDAFCGALVMKI----GNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVN
1viaA           QKVSEIFEQKRENFFREQEQKXADFFSSCEKACIATGGGFVNFCIYLKADFEYLKKRLDKDEISKRPLFY
1l3aA           LTVEPRS--PEFSPLDSGAFKLSREGMVMLQFAPAARQYDWSRKQVFSLSVTEIGSIISLTKDSCEFFHD
1afrA           DGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM--DPRTENSPY
1atrA1          KNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAVLTKMKEIAEAYLGKTVTNAVVTVPAY
1mjgM           SKLPLG--------ILVDIYGRKMQ---ADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKG
1oa8A           -------------------PPYFMKGSIIQLANGELKKVQSAEISNDLKIDSSTVERIEDSHSPGVAVIQ
1grqA           LIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWA-EGVVAMARAGARIIIDDVFLGGAAAQERWRS
2ancF1          FLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYYLIVNDDFD
1jbkA           GALV----AGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGAT
2fggA1          ----------------------------------------------HVGKTCQIDVLIEEHDERTRAKAR
1ffhA2          -------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE---------EKARLEARDLILVD
1fl9A           SPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLSEKGQGILPEVNIDYYDDARNIE
1ni3A1          A--------VPDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRA
1zp6A1          ---------GRIDPWLPQSHQQNRXIXQIAADVAGEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTA
1es6A2          ---------------------LRPGISFHPKLRPINKNSADLTSPEKIQAIMTSLQDFKIVPIDP--TKN
1ii8.1          AKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLER
1ak2A1          SGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSV
1mi8A           DGWKRLDELSLKEHIALPRKSDISWDSIVSITETGVEEVFDLTVPGPHNFVANDI---------------
1t9hA2          ---------EEELGYTFPDIREKSSSCKFRGCLHL-----KEPKC----AVKQAVEDGELKQYRYDHYVE
2gtlM1          DDDHADCKIVVPSLFVCAHFNAQRY---------------------------------------------
2pa7A1          -------------------RGSLVAIEENKNIPFSIKRVYY---------IFDTKGEEPRGFHAHKKLEQ
1jb1A           VGAAP---------PILSHLLEIRGLGIIDVLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKITVP
1gm5A1          -------------------SSLFLWGEALPTLLEEFLNEVEKMLKNQVNTR-RIHQLLKELDDPLLENKD
1tmkA           INEYLTDDSFQLSDQAIHLLFSANRW-----------EIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKG
2v3jA1          ITH-----QCLLTLLDSPINKAGKLQVY--IQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSE
1xl3C1          ---------------------YDLSEFMGDIVALVDXRWAGIHDFSLPTPEIXVRFYQDLXRMFRLFPLG
1ckvA           KIEVDCDEISELLGRQFNVYDFLVDVS---------STIGRAYTLGNKFTITSELMGLDR----------
1g6oA           DTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAG
1tljA           PWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGW-DILKIAREAGFKHSG
1d6jA           GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIA---------------ITSFISPYRKDRDTARQLHEV
1puoA2          PIFYDVFFAVANGNELLLDLSLTVNATEPERTAMKKIQ-DCYVENGLISRVLDGLVMTTISSSKD-----
1f2t.1          IFLNAIYIRQGQIDAILESAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPTF
1q3tA           LGVEEVLALLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTN----HVSAIAAIPEVREKLVSLQQE
1udwA           QKAK-----ALKGQFNFDHPDAFDNELILKTLKEITEG-----------KTVQIPVYDFVSHSRKEETVT
2vgmA3          ----------------------------------------------EIMVMDEFLLHLNKDDD------K
1g8yA           PTGPVIYLPAEDPPTAIHHRLHALG--------------AHLSAEERQAVADGLLIQPLIGSLPNIMAPE
1qhdA1          MNWTDLITNYSPSREDNLQRVFT-VASIRSMLV-------------------------------------
1ovmA2          R--------GELLHHTLGDGEFRHFYHMSEPITVAQVLTEQNACYEIDRVLTTMLRERRPG---------
1g8fA3          LLSLI--QDFIGSGSGLIIPDQWEDDKDSVVGKQNQLESADEPISHIVQKVVLFLEDNGFFV--------
1lw7A2          FEKLGGDEQAMQYSDYPQXALGHQRY-----------------IDYAVRHSHKIAFID-TDFITTQAFCI
1d8jA           --------------------------------------VLAKIVNYMKTRHQRGDTHPLTLDEILDETQH
1e3mA2          DRIFTRVGF----XVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWAC--AENLANKIKALTLF
3cddA2          PSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIK---VIVNTDVGEPFQRIQ
1cd5A           NDGHIAFNEPASSLASRTRIKTLTHDTRVANSVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAA
1sbxA           -------------------------------------------------------------------PSD
1o7d.2          ---------------------------------------------------FAFCRKLNISICPTAERFQ
1v47A1          ----------------------------------------------------------------------
1iqrA2          ------------------------------------------LRLHDHPALLEALARGPVVGLVVLDPNN
1w1wA           SYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNKRFKDMEY
1mkyA1          FKLVDTCGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLAFLRKSTVDTILVANKAE
1b77A2          LTRPKY-----SLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYIAMEADST
1yj5A2          VSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVS
1f8xA           -------------------------------------------------------KTIYFG------AGW
1vhhA           ------------------------------------------TPLAYKQFIPNVAEK-TLGASGRYEGKI
1j90A           ---ELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT--
1np6A           AGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTS-----------------------KLDLILVEG
2vnuD1          ----------------------------------------------------------------------
1iioA           ------------------------------HMKMGVKEDIRGQIIGALAGAEELMAALGPDTTCKSGDVE
2gujA1          FDSAKIASLDEEVPFTFEDFDVPEKL--------------------------------------------
2bsqE1          -------------------------RNLSEATHNAIKFRARSTEAEIRLILDNIAKAQQTVRLGASIGQE
1em8A           ----------------------------------------------------------------------
1yr6A1          PYEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFH
1esmA           PNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNV---------------------------TAPV
1e6vC           -----------------------------------------------------------------AENRR
1yvuA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1jqjA3          EIGFNVSYVLDVLNALKCENVRM-MLTDSVSSVQI--------EDAASQSAAYVVMPMRL----------
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIA
1pgsA2          ANTFQHQLGALGCSANPINNQSPGNWTPDRAGWCGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNG
1odfA           -------------------LTHEDQLKLNEQFKNNKLLQGRGLPGTDMKLLQEVLNTIFNQDTVVLYDKS
1l1oA           PLDEEISGIVEVVGRVTAKATIL-CTSYVQFKEDSH-PFDLGLYNEAVKIIHDFPQF-------------
1tueA           TDTKVAM------LDDATTTCWTYFDTYMRNALDGNPISIDPLIQ-------------------------
1g31A           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           VASEDALPLASHLDVRFVSTNGNLEVILEGEDVS-----GEIRTQEVANAASQVAAFPRVREALLRRQRA
2je6I3          EAIRKI----------------------------------------------------------------
1xkpA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1p5zB           TNLQMMYEKPERWSFTFQTYACLSRIRAQLASLNG-----------------------------------


                         +         .         .         .         .         *         .:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSALDPXXXXXXXXXXXXXXXXXXSLIIVTHNLAFAQKVADKI
1b0uA           LSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHV
1sgwA           LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDESKHKVLKSILEILKEKGIVIISSREELSY----CDVN
1q3hA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-KMEHLRKADKI
1ji0A           LSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYG
1m3eA1          IKYNKDGSIAIASKPREVREFNGQHFILEEAIR-GDFALVKAWKADQAGNVTFRKSARNFNLPXCKAAET
1e69A           LSGGEKALVGLALLFALPSPFYVLDEVDSPLDD-YNAERFKRLLKENSKHTQFIVITHNKIVME-AADLL
1ex6A           KSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDF
2yyeA2          KSNLDNWKLILLSDPVTSGGLLFTINKEKLEK--------------------------------------
1l7vC           LSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHRA
1nijA1          IIQTFFSHEVLCQRYLLDGVIALVDAVHADEQM---NQFTIAQSQVGYADRILLTKTDVAGEAEKLHERL
1pf4A1          LSGGQRQRVAIARALLRDAPVLILDEATSALDT-ESERAIQAALDELQKNKTVLVIAHRLST-IEQADEI
1e9rA           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGD
2gk3A1          IDELNRYDVIVISDIGSNTFLLQNETFYQLKIK---PNALESIKEYVKNGGGLLXIGGYLSFGIEAKANY
1mukA           IMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDG---------RHLNTDIPPRMGWLRAIL
1qhlA           MTDYHSLMFDLLRSASDRSKFYRLIEASGGISS-------------------------------------
1t06A           WIASGDELSCYCWLLGNRKDNAFSESKISDMLEVKDTIHHSPERTKSAMNNFLNTVAPLHEKAVEIAKEV
2iqhA1          LRGSVAHKSCLPACVYGSAVASGYDFEREGYSL------VGIDPFRLLQNSQVYSLIRPNENPAHKSQLV
1vplA           YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRI
1bgxT2          KAGRAPTPEDFPRQLALIKEVDLLGLARLEVPGYEADDVLASLAKKAEKEGEVRILTADKDLYQLLSDRI
2gx8A1          VVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGNIVDPGHNVVMKQGVQKQL
1jjvA           LAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRI--MNSQVSQQERLKWADDV
1urjA           GGFEQRLASVMAGDAAIVSMAVFDEPPTDISAW-------------------------------------
1ohcA1          TGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRITSYIPFRDAAYGSCNFYITLLDCFHAVKKA-------
1c4oA1          SVSAIYGLGDPREYRARNLVGFVLFPATHYLSP-------------------------------------
1xbtA1          PFGAILNLVPLAESV-------------------------------------------------------
1khbA1          WKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEAL--SWQHG
2axpA1          IGKDIDSILELYREVXSNAGLHTYSWDTGQWSS-------------------------------------
1n25A           LQARFVKQIDFRPKDYLKHCLERSEFLLEKRIISGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEF
1g6hA           LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHL
1poiA           SKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIKFQDVDIAE--AAKY
1bmfA3          QAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLL-ERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNV
1f46A           ELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTP-------------------------------------
1jalA1          DIDTINTELALADLDSCERAIQRLQKRAKGGDKAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSY
1zs3A1          LLLDENEIVPSTTEEFLKYHKFITEDPKAKYWT----DEDLLESFIVDFQAQNMFITRAIKLANKEEK--
1bs2A1          LRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTY---LFKLTHQVS
1j1zA2          VNGERLSPAAL----LQRLNEIGGRHGVGRVDIENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREV
1mm8A           RKAGAMQTVKL----AQEFPELLAIEDTTSL-SYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRT
2f9hA1          FANSNLQSIAHSTLIFADAPTDEDDVIRNGVY--------------------------------------
1rkbA           KKLTDNIQCEIFQVLYEEATASYKEEIVHQLPS-------------------------------------
1i1qA           --RAVLRAIATAHH--------------------------------------------------------
1dnpA2          HNMSPRQAELINAQLNGQIALAEKGIPLLFREVDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVE
1pv4A3          TRLARAYNTVVPAVLTGGVDANALHRPKRFFGA-----ARNVEEGGSLTIIATALIDTGSKXDEVIYEEF
1dhyA1          MAAGSAGDAALYRADQRAWRIAVQPGELDDLAYLEVDDAAALERMADKLRQAGVAFTRGDEALM--QQRK
1e6cA           PTLTGRPIAEEMEAVLREREALYQDVAHYVVDA-------------------------------------
1t3wA           FTDSLNHXFDSL--LELRQEELIARERTHGLSN-------------------------------------
1cr0A           AEAETDRLLAKLAYMGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTI
1kgdA           PQALKVLRTAEFAPFVVFIAAPTIGLNEDESLQ-RLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEA
1s9hA           VIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFG-------------------------------------
3cddA1          TIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAA-------------------------------------
1bccF           -KEQWTKYEEDVPYLEPYLKEVI-----------------------------------------------
2qgmA1          EPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYI
1l7lA           IGKDQS----------------------------------------------------------------
1viaA           DEIKAKKLYNERLSKYEQKANFILNIENKNIDE-------------------------------------
1l3aA           PNKGRSDEGRVRKVLKVEPL---PDGSGHFFNL-------------------------------------
1afrA           LGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAADEKR------HETAYTKIVEKLFEIDPDG
1atrA1          FNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA-------------------------------------
1mjgM           FRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEVKEYMEVAREKYKERDDRMRGLTDETVDTFYSAPNHV
1oa8A           FAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL------------
1grqA           FVGDLDVLWV-----GVRCDGAVAEGRETARGDVAGMAAKQAYVVHEGVEYDVEVDTTHKE-SIECAWAI
2ancF1          TALTDLKTIIRAERLRMSRQKQRHDALISKLL--------------------------------------
1jbkA           TLDEYRQYIEKDAALERRFQKVFVAEPSVEDTI-------------------------------------
2fggA1          LSWAGRQXVGVGLARLDPA-----DEPVAQIGD-----ELAIARALSDLANQLFALTSSDIEA-------
1ffhA2          TAGRLQIDEPLMGELARLKEVLGPDEVLLVLDATGQEALSVARAFDEKVGVTGLVLTKLDGDAGGAALSA
1fl9A           LIAQTNLGKNIISAFS------------------------------------------------------
1ni3A1          FDDAEIIHVEGDV--DPIRDLSIIVDELLIKDA-------------------------------------
1zp6A1          AEAIERCLDRGGDSLSDPLVVADLHSQFADLGA----------------FEHHVLPVSGKDTDQALQSAI
1es6A2          IMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDP-------------------------------------
1ii8.1          IALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELK-DAADHV
1ak2A1          IEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIASQTPDVVFASILAA
1mi8A           ----------------------------------------------------------------------
1t9hA2          FMTEIKDR--------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2pa7A1          VLVCLNGSCRVILDDGNIIQEITLDSPAVGLYV--GPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYD
1jb1A           VKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEK-------------------------------------
1gm5A1          LEEKLQAFLDYV------KEIPNLPEARKRYRI-------------------------------------
1tmkA           TNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVKQ--------TFMKLLDKEIRKGDESI
2v3jA1          EKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRV-----QDYIEKLDDDESICVFVGAXARGKDNFAVDEK
1xl3C1          VFSDEEQRQNLLQMCQNAIDMAIESE--------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6oA           SSEEAFIRLASSNSAARNKFESLIEGFKDLID--------------------------------------
1tljA           ILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD-----------
1d6jA           ATPGEETGLPFVEVYVDVPVEAPYEAPANPEV--------------------------------------
1puoA2          ----------------------------------------------------------------------
1f2t.1          LSGGEAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD-AADHV
1q3tA           I-AQQGGIVMDGRDIG---TVVLPQAELKIF---------------------------------------
1udwA           VYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEE
2vgmA3          AWYGE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLT
1g8yA           WFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYL
1qhdA1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1lw7A2          QYEGKAHPFLDSXIKEYPFDVTILLKNN------------------------------------------
1d8jA           LDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPK-------------------------------------
1e3mA2          ATHYFELTQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVAALAVPKEVIKRARQKLREL
3cddA2          IEQGETPHELLARLAK-QRGVLLTSDTFGNLVI-------------------------------------
1cd5A           VEGCVNHMWTISCLQLHPKAIMVCDEPSTMELK-------------------------------------
1sbxA           RSTERCEGETISCFVVGGEKRLCLPQILNS--VLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGIL
1o7d.2          VNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPS-DVVTIPSSDSQELLFSALVPAVGFSIYSV-SQMPRD
1v47A1          ------PALEIGEDERLDLE-NLATGAFFPVKGFMTREEALSVAHEMRLPTGEVPILLREKPRVGPGNTV
1iqrA2          LKTTPRRRAWF------LENVRALREAYRARGGLEGLPWEKVPEAARRLKAKAVYALTSHTPYGRYRDGR
1w1wA           LSGGEKTVAALALLFAIPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEK-SDAL
1mkyA1          NLREFEREVKPELYSLGFGEPI----PVSAEHN-------------------------------------
1b77A2          HD--------------------------------------------------------------------
1yj5A2          DXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEH-------------------------------------
1f8xA           FTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIM
1vhhA           TRNSERFKELTPN---YNPDIIFKDEENTGADRRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEE
1j90A           ---LEEWYKFIEESIHVQALIIYLRTS-------------------------------------------
1np6A           FKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVAVPLNLDVALLDINDVEGLADFVVEWMQKQ--------
2vnuD1          ----------------------------------------------------------------------
1iioA           LKASDAGQVLTADDFPFSAEEVADTIVNKA----------------------------------------
2gujA1          ----------------------------------------------------------------------
2bsqE1          IGGVELEDVR------------------------------------------------------------
1em8A           ----------------KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGRVLIACEDEKQAYRLDEAL
1yr6A1          EFGVRLMENLPYPLVVYISDPE------------------------------------------------
1esmA           YSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRF
1e6vC           KYMNPNYELKKLREIPDEDIVRLMGHREPGEEY-------------------------------------
1yvuA2          -TRDGKTVNAVAFTKIFNSKGELVRYYLTSYPA--------FGEKLTEKAIGDVFSLLEKLGFKK-GSKI
1uouA3          ---------------------------------------------------PLALVLHELGALRLGVGAE
1jqjA3          ----------------------------------------------------------------------
1e2hA           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPG-------------------------------------
1pgsA2          DAFYA-----------------------------------------------------------------
1odfA           QFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNP-------------------------------------
1l1oA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1g31A           -----------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGE---VPELCVVHSVGPDVPEGF
1a4iA2          ------------------PAEILNGKEISAQI--RARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLY
1ckeA           FRELPGL---IADGRDMGTVVFPDAPVKIFLDSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALV
2je6I3          ----------------------------------------------------------------------
1xkpA1          ---------QFXMLCGLRDALXGRPELAHLSHLVEQALVSMAEEQGET----IVLGARITPEAYRESQSG
1dwmA           -----------------------------------------------------VLKEGSAMTKDFRCDRV
1p5zB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLxxxx
1b0uA           IFLHQGKIEEEGDPEQVFNPQSPRLQQFLKG-------
1sgwA           ENLHKY--------------------------------
1q3hA           LILHQGSSYFYGTFSELQSLRPDFSSKLMGY-------
1ji0A           YVLETGQIVLEGKASELLDNEXVR--------------
1m3eA1          TVVEVEEIVDIGSFAP----------------------
1e69A           HGVVNG--------------------------------
1ex6A           IFAE----------------------------------
2yyeA2          --------------------------------------
1l7vC           WLLKGGKXLASGRREEVLTPPN----------------
1nijA1          ARINARAPVYTVTHGDIDLGLFMLEENVVSTK------
1pf4A1          LVVDEGEIIERGRHAD----------------------
1e9rA           FSIRSWLEDPNGGNLFITWREDMGPALRPLIS------
2gk3A1          KNTVLAEVLPVIXLDG----------------------
1mukA           RFLGAGMVMTAT--------------------------
1qhlA           --------------------------------------
1t06A           GIVEVKRD---NKKSSLLNASESIQKELDRGRLG----
2iqhA1          WMACHSAAFEDLRVSSFIRGTKVVPRGKLS--------
1vplA           ALIHNGTIVETGTVEELKRYKAQNIEEVFEEV------
1bgxT2          HVLHPEGYLITPA-------------------------
2gx8A1          QEKVDAKKLNVHIHASQLHTD-----------------
1jjvA           INNDAELAQNLPHLQQKVL-------------------
1urjA           --------------------------------------
1ohcA1          --------------------------------------
1c4oA1          --------------------------------------
1xbtA1          --------------------------------------
1khbA1          VFVGAAMRSEAKIIMHDPFAMRPFFGYN----------
2axpA1          --------------------------------------
1n25A           SLSVYQKMK-----------------------------
1g6hA           YVMFNGQIIAEGRGEEEIKSDPKVVEIYI---------
1poiA           TIVTCEEII----SDEEIRRDPTKN-------------
1bmfA3          ISITDGQIFLETELFYKGIRP-----------------
1f46A           --------------------------------------
1jalA1          NFLTLKPTMYIANVNEDGFENN----------------
1zs3A1          --------------------------------------
1bs2A1          SCYDVLWVAGQTEELATALALYGAARQVLYNG------
1j1zA2          LHQRDMLSPKYAELVYYGFWYAPE--------------
1mm8A           VGLLHQEWWMRPDDPADADEKESGKWLAA---------
2f9hA1          --------------------------------------
1rkbA           --------------------------------------
1i1qA           --------------------------------------
1dnpA2          VERALRNVVCEGFDDSVIL-------------------
1pv4A3          KGTGNXELHLSRPAIDYNRS------------------
1dhyA1          VMGLLCLQDPFGLPLEIYGPAEIFHEPFLPSA------
1e6cA           --------------------------------------
1t3wA           --------------------------------------
1cr0A           IALERNQLLVRILKCRFTGDTG----------------
1kgdA           V-------------------------------------
1s9hA           --------------------------------------
3cddA1          --------------------------------------
1bccF           --------------------------------------
2qgmA1          QTGKGNPREFLKLLYPTD--------------------
1l7lA           --------------------------------------
1viaA           --------------------------------------
1l3aA           --------------------------------------
1afrA           TVLAFADMMRKKISMPAHL-------------------
1atrA1          --------------------------------------
1mjgM           CIVTPERVGLCGAVSWL---------------------
1oa8A           --------------------------------------
1grqA           A-------------------------------------
2ancF1          --------------------------------------
1jbkA           --------------------------------------
2fggA1          --------------------------------------
1ffhA2          RHVTGKPIYFAGLEPFYPERLAGRI-------------
1fl9A           --------------------------------------
1ni3A1          --------------------------------------
1zp6A1          NALQSGRF------------------------------
1es6A2          --------------------------------------
1ii8.1          IRISLENGSSKV--------------------------
1ak2A1          F-------------------------------------
1mi8A           --------------------------------------
1t9hA2          --------------------------------------
2gtlM1          --------------------------------------
2pa7A1          NFKKYIAKI-----------------------------
1jb1A           --------------------------------------
1gm5A1          --------------------------------------
1tmkA           TIVDVTNKGIQEVEALIWQIVEPVLSTHI---------
2v3jA1          VGLSNY--------------------------------
1xl3C1          --------------------------------------
1ckvA           --------------------------------------
1g6oA           --------------------------------------
1tljA           --------------------------------------
1d6jA           --------------------------------------
1puoA2          --------------------------------------
1f2t.1          IRI-----------------------------------
1q3tA           --------------------------------------
1udwA           FCLPTKKIPRGADNLVAINLIVQHIQDILN--------
2vgmA3          --------------------------------------
1g8yA           SSMTSAEAEEWGVDDDQRR-------------------
1qhdA1          --------------------------------------
1ovmA2          --------------------------------------
1g8fA3          --------------------------------------
1lw7A2          --------------------------------------
1d8jA           --------------------------------------
1e3mA2          --------------------------------------
3cddA2          --------------------------------------
1cd5A           --------------------------------------
1sbxA           PFSPSCGLITKTDAERLCNA------------------
1o7d.2          LVIQNEYL------------------------------
1v47A1          ALLHGGERVALLHVAEAYELD-----------------
1iqrA2          V-------------------------------------
1w1wA           VGV-----------------------------------
1mkyA1          --------------------------------------
1b77A2          --------------------------------------
1yj5A2          --------------------------------------
1f8xA           LGVYIPDEEDVGLGMELG--------------------
1vhhA           SLHYEGRAVDITTSDRDR--------------------
1j90A           --------------------------------------
1np6A           --------------------------------------
2vnuD1          --------------------------------------
1iioA           --------------------------------------
2gujA1          --------------------------------------
2bsqE1          --------------------------------------
1em8A           WARPAESFVPHNLAGE----------------------
1yr6A1          --------------------------------------
1esmA           LKFREGAFTDPDYFHNYAKLTKEEAIKTA---------
1e6vC           --------------------------------------
1yvuA2          VVHRDGRL------------------------------
1uouA3          LLVDVGQRLRRGTPWLDGPALSGPQSRALQEA------
1jqjA3          --------------------------------------
1e2hA           --------------------------------------
1pgsA2          --------------------------------------
1odfA           --------------------------------------
1l1oA           --------------------------------------
1tueA           --------------------------------------
1g31A           CEVGDLTSLPVG--------------------------
1a4iA2          INVKLKAAEEIGIKATHI--------------------
1ckeA           LDSTTLSI------------------------------
2je6I3          --------------------------------------
1xkpA1          VNPLQPLRDTYRDAVMGYQGIYAIWS------------
1dwmA           WVIVNDHGVVTS--------------------------
1p5zB           --------------------------------------