[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00433.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b48A1.bssp"
#ERROR : Can't open dsspfile "3cr3C1.bssp"

## Summary of PDB Search
:122
    1e-21  32%  3b48A1 [c.54.1.2] UNCHARACTERIZED PROTEIN A:1 -- 132
    3e-13  51%  3cr3C1 [c.54.1.2] PTS-DEPENDENT DIHYDROXYACETONE KINASE, C:3 -- 123
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
3b48A1          ----ILLVSHSKXITDGIKEXIEQXNEEITIHSLGGTSDGSLGSDPXKIIDTINEDSDREFLIFADLGSA
3cr3C1          ---GIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVXNAIEENEADNLLTFFDLGSA


                         .         .         *         .         .         .         .:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLExxxxx
3b48A1          VLSSELAFDXLEKHYHLVDAPLVEGAFASAI-TAGSDDLTQILAEAQ-----
3cr3C1          RXNLDLVSEXTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLE-----