[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rlmA.bssp"
#ERROR : Can't open dsspfile "1iwoA4.bssp"
#ERROR : Can't open dsspfile "1v93A.bssp"
#ERROR : Can't open dsspfile "1rkqA.bssp"
#ERROR : Can't open dsspfile "1qwgA.bssp"
#ERROR : Can't open dsspfile "1iwoA2.bssp"
#ERROR : Can't open dsspfile "1v6tA.bssp"
#ERROR : Can't open dsspfile "1np7A2.bssp"
#ERROR : Can't open dsspfile "2b8eA1.bssp"
#ERROR : Can't open dsspfile "1judA.bssp"
#ERROR : Can't open dsspfile "1dioG.bssp"
#ERROR : Can't open dsspfile "1te2A.bssp"
#ERROR : Can't open dsspfile "2feaA1.bssp"
#ERROR : Can't open dsspfile "1owlA2.bssp"
#ERROR : Can't open dsspfile "1nf2A.bssp"
#ERROR : Can't open dsspfile "2b0cA1.bssp"
#ERROR : Can't open dsspfile "1gdhA2.bssp"
#ERROR : Can't open dsspfile "1un8A1.bssp"
#ERROR : Can't open dsspfile "2b8eA2.bssp"
#ERROR : Can't open dsspfile "2go7A1.bssp"
#ERROR : Can't open dsspfile "2pjuA1.bssp"
#ERROR : Can't open dsspfile "2fi1A1.bssp"
#ERROR : Can't open dsspfile "1s2oA1.bssp"
#ERROR : Can't open dsspfile "1f5sA.bssp"
#ERROR : Can't open dsspfile "1rkuA.bssp"
#ERROR : Can't open dsspfile "1iwoA1.bssp"
#ERROR : Can't open dsspfile "1j49A2.bssp"
#ERROR : Can't open dsspfile "2a0mA1.bssp"
#ERROR : Can't open dsspfile "1j8dA.bssp"
#ERROR : Can't open dsspfile "1lplA.bssp"
#ERROR : Can't open dsspfile "1a9xA2.bssp"
#ERROR : Can't open dsspfile "1xviA.bssp"
#ERROR : Can't open dsspfile "2bduA1.bssp"
#ERROR : Can't open dsspfile "1aonO.bssp"
#ERROR : Can't open dsspfile "2b30A1.bssp"
#ERROR : Can't open dsspfile "1lvhA.bssp"
#ERROR : Can't open dsspfile "2gmwA1.bssp"
#ERROR : Can't open dsspfile "1ymqA1.bssp"
#ERROR : Can't open dsspfile "1g61A.bssp"
#ERROR : Can't open dsspfile "1dgsA2.bssp"
#ERROR : Can't open dsspfile "1kytA.bssp"
#ERROR : Can't open dsspfile "1wzcA1.bssp"
#ERROR : Can't open dsspfile "1u2zA.bssp"
#ERROR : Can't open dsspfile "1xpjA.bssp"
#ERROR : Can't open dsspfile "1wr8A.bssp"
#ERROR : Can't open dsspfile "1zq1A1.bssp"
#ERROR : Can't open dsspfile "1nrwA.bssp"
#ERROR : Can't open dsspfile "1ynsA1.bssp"
#ERROR : Can't open dsspfile "2g80A1.bssp"
#ERROR : Can't open dsspfile "1svjA.bssp"
#ERROR : Can't open dsspfile "1l8lA.bssp"
#ERROR : Can't open dsspfile "1iwoA3.bssp"
#ERROR : Can't open dsspfile "2fdrA1.bssp"

## Summary of PDB Search
:643
    9e-27  14%  1rlmA  [c.108.1.10] PHOSPHATASE
    3e-26  10%  1iwoA4 [f.33.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:1 --
    3e-24   8%  1v93A  [c.1.23.1] 5,10-METHYLENETETRAHYDROFOLATE REDUCTASE
    3e-22  18%  1rkqA  [c.108.1.10] HYPOTHETICAL PROTEIN YIDA
    5e-22  12%  1qwgA  [c.1.27.1] (2R)-PHOSPHO-3-SULFOLACTATE SYNTHASE
    6e-22  29%  1iwoA2 [c.108.1.7] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:344
    7e-22  13%  1v6tA  [c.6.2.5] HYPOTHETICAL UPF0271 PROTEIN PH0986
    8e-20  10%  1np7A2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 204
    4e-19  37%  2b8eA1 [c.108.1.7] CATION-TRANSPORTING ATPASE A:416 -- 434 A:548 --
    3e-18  12%  1judA  [c.108.1.1] L-2-HALOACID DEHALOGENASE
    1e-17  11%  1dioG  [a.23.2.1] PROTEIN (DIOL DEHYDRATASE)
    1e-16  14%  1te2A  [c.108.1.6] PUTATIVE PHOSPHATASE
    5e-16  11%  2feaA1 [c.108.1.20] 2-HYDROXY-3-KETO-5-METHYLTHIOPENTENYL-1- A:2 --
    2e-15  12%  1owlA2 [c.28.1.1] DEOXYRIBODIPYRIMIDINE PHOTOLYASE A:3 -- 204
    1e-14  14%  1nf2A  [c.108.1.10] PHOSPHATASE
    1e-14   8%  2b0cA1 [c.108.1.2] PUTATIVE PHOSPHATASE A:8 -- 204
    2e-14  10%  1gdhA2 [c.23.12.1] D-GLYCERATE DEHYDROGENASE A:2 -- 100 A:292 --
    3e-14  18%  1un8A1 [a.208.1.1] DIHYDROXYACETONE KINASE A:336 -- 550
    5e-14  38%  2b8eA2 [d.220.1.1] CATION-TRANSPORTING ATPASE A:435 -- 547
    7e-14  10%  2go7A1 [c.108.1.6] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:3
    2e-13  10%  2pjuA1 [c.92.3.1] PROPIONATE CATABOLISM OPERON REGULATORY PROTEIN
    4e-13  11%  2fi1A1 [c.108.1.3] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:4
    4e-13  11%  1s2oA1 [c.108.1.10] SUCROSE-PHOSPHATASE A:1 -- 244
    5e-13  21%  1f5sA  [c.108.1.4] PHOSPHOSERINE PHOSPHATASE (PSP)
    2e-12  14%  1rkuA  [c.108.1.11] HOMOSERINE KINASE
    3e-12  22%  1iwoA1 [b.82.7.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:125
    4e-12  13%  1j49A2 [c.23.12.1] D-LACTATE DEHYDROGENASE A:1 -- 103 A:301 -- 332
    4e-12   7%  2a0mA1 [c.42.1.1] ARGINASE SUPERFAMILY PROTEIN A:13 -- 310
    5e-12  23%  1j8dA  [c.108.1.5] DEOXY-D-MANNOSE-OCTULOSONATE 8-PHOSPHATE
    5e-12  15%  1lplA  [b.34.10.1] HYPOTHETICAL 25.4 KDA PROTEIN F53F4.3 IN
    7e-12   8%  1a9xA2 [c.24.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    1e-11  13%  1xviA  [c.108.1.10] PUTATIVE MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE
    1e-11  20%  2bduA1 [c.108.1.21] CYTOSOLIC 5'-NUCLEOTIDASE III A:7 -- 297
    1e-11  20%  1aonO  [b.35.1.1] GROEL/GROES COMPLEX
    3e-10  26%  2b30A1 [c.108.1.10] PVIVAX HYPOTHETICAL PROTEIN A:18 -- 300
    8e-10  14%  1lvhA  [c.108.1.6] BETA-PHOSPHOGLUCOMUTASE
    2e-08  15%  2gmwA1 [c.108.1.19] D,D-HEPTOSE 1,7-BISPHOSPHATE PHOSPHATASE A:24
    4e-08  29%  1ymqA1 [c.108.1.10] SUGAR-PHOSPHATE PHOSPHATASE BT4131 A:2 -- 261
    7e-08  14%  1g61A  [d.126.1.1] TRANSLATION INITIATION FACTOR 6
    2e-07  12%  1dgsA2 [b.40.4.6] DNA LIGASE A:315 -- 400
    3e-07  20%  1kytA  [c.108.1.10] HYPOTHETICAL PROTEIN TA0175
    4e-07  25%  1wzcA1 [c.108.1.10] MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE A:1 --
    2e-06  23%  1u2zA  [c.66.1.31] HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-79
    2e-06   9%  1xpjA  [c.108.1.18] HYPOTHETICAL PROTEIN
    3e-06  26%  1wr8A  [c.108.1.10] PHOSPHOGLYCOLATE PHOSPHATASE
    3e-06  16%  1zq1A1 [b.38.3.1] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT D A:2
    3e-06  19%  1nrwA  [c.108.1.10] HYPOTHETICAL PROTEIN, HALOACID DEHALOGENASE-LIKE
    6e-06  13%  1ynsA1 [c.108.1.22] E-1 ENZYME A:4 -- 256
    1e-05  11%  2g80A1 [c.108.1.22] PROTEIN UTR4 A:17 -- 241
    1e-05  24%  1svjA  [d.220.1.1] POTASSIUM-TRANSPORTING ATPASE B CHAIN
    6e-05  18%  1l8lA  [c.108.1.4] L-3-PHOSPHOSERINE PHOSPHATASE
    3e-04  14%  1iwoA3 [d.220.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:361
    6e-04  16%  2fdrA1 [c.108.1.6] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 224
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1rlmA           ----------------------------------------------------------------------
1iwoA4          ----------------------------------------------------------------------
1v93A           ----------------------------------------------------------------------
1rkqA           ----------------------------------------------------------------------
1qwgA           ----------------------------------------------------------------------
1iwoA2          ----------------------------------------------------------------------
1v6tA           ----------------------------------------------------------------------
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1dioG           ----------------------------------------------------------------------
1te2A           ----------------------------------------------------------------------
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           ----------------------------------------------------------------------
2b0cA1          ----------------------------------------------------------------------
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          ----------------------------------------------------------------------
2go7A1          ----------------------------------------------------------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------------
1iwoA1          ----------------------------------------------------------------------
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           ----------------------------------------------------------------------
1lplA           ----------------------------------------------------------------------
1a9xA2          ----------------------------------------------------------------------
1xviA           ----------------------------------------------------------------------
2bduA1          ----------------------------------------------------------------------
1aonO           ----------------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           ----------------------------------------------------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          ----------------------------------------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------------------------------------------
2g80A1          ----------------------------------------------------------------------
1svjA           ----------------------------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxITNLLDIRPEYANLELNGKLQQVKPELLN
1rlmA           ----------------------------------------------------------------------
1iwoA4          ----------------------------------------------------------------------
1v93A           ----------------------------------------------------------------------
1rkqA           ----------------------------------------------------------------------
1qwgA           ----------------------------------------------------------------------
1iwoA2          ----------------------------------------------------------------------
1v6tA           ----------------------------------------------------------------------
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1dioG           ----------------------------------------------------------------------
1te2A           ----------------------------------------------------------------------
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           ----------------------------------------------------------------------
2b0cA1          ----------------------------------------------------------------------
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          ----------------------------------------------------------------------
2go7A1          ----------------------------------------------------------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------------
1iwoA1          ---------------------------------------------------------RKSVQRIKARDIV
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           ----------------------------------------------------------------------
1lplA           ----------------------------------------------------------DKLNEEAAKNIM
1a9xA2          ----------------------------------------------------------------------
1xviA           ----------------------------------------------------------------------
2bduA1          ----------------------------------------------------------------------
1aonO           ---------------------------------------------MNIRPLHDRVIV----KRKEVETKS
2b30A1          ----------------------------------------------------------------------
1lvhA           ----------------------------------------------------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          -----------------------------------------VLEPVFIEGSEVSRVTLHNESYIEELDIR
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          -------------------------------------------------------------EFLKERNIN
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------------------------------------------
2g80A1          ----------------------------------------------------------------------
1svjA           ----------------------------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
1rlmA           ----------------------------------------------------------------------
1iwoA4          ----------------------------------------------------------------------
1v93A           ----------------------------------------------------------------------
1rkqA           ----------------------------------------------------------------------
1qwgA           ----------------------------------------------------------------------
1iwoA2          ----------------------------------------------------------------------
1v6tA           ----------------------------------------------------------------------
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1dioG           ----------------------------------------------------------------------
1te2A           ----------------------------------------------------------------------
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           ----------------------------------------------------------------------
2b0cA1          ----------------------------------------------------------------------
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          ----------------------------------------------------------------------
2go7A1          ----------------------------------------------------------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------------
1iwoA1          PGDIVEVAVGDKVPADIRIKSTTLRVDQSILTGESVSVIKHKKNMLFSGTNIAAGKALGIVATTGVSTEI
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           ----------------------------------------------------------------------
1lplA           VGNRCEVTVGAQMARRGEAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYPKYGGFVRPVDVKVGDFP
1a9xA2          ----------------------------------------------------------------------
1xviA           ----------------------------------------------------------------------
2bduA1          ----------------------------------------------------------------------
1aonO           AGGIVLTGSAAAKSTRGEVLAVGN--GRILENGEVKPLDVKVGDIVIFNDGYGVKSEKIDN-EEVLIMSE
2b30A1          ----------------------------------------------------------------------
1lvhA           ----------------------------------------------------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          IGDWVLVHAGGVIPEVLRVLKERRTGKERPI---------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          VGDFVRITKEEDVTYEGYIXPPGDTLVLKLENGYNIGIALEKIRRI------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------------------------------------------
2g80A1          ----------------------------------------------------------------------
1svjA           ----------------------------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKILELVQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFLGQEFQVWLYRALIFLVISCPCAL
1rlmA           ----------------------------------------------------------------------
1iwoA4          ----------------------------------------------------------------------
1v93A           ----------------------------------------------------------------------
1rkqA           ----------------------------------------------------------------------
1qwgA           ----------------------------------------------------------------------
1iwoA2          ----------------------------------------------------------------------
1v6tA           ----------------------------------------------------------------------
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1dioG           --------------------------------------------NKHPEWVKTATNKTLDDFTLENVLSN
1te2A           ----------------------------------------------------------------------
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           ----------------------------------------------------------------------
2b0cA1          ----------------------------------------------------------------------
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          ----------------------------------------------------------------------
2go7A1          ----------------------------------------------------------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------------
1iwoA1          GKIRDQM---------------------------------------------------------------
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           ----------------------------------------------------------------------
1lplA           ELSID-----------------------------------------------------------------
1a9xA2          ----------------------------------------------------------------------
1xviA           ----------------------------------------------------------------------
2bduA1          ----------------------------------------------------------------------
1aonO           SDILAIVE--------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           ----------------------------------------------------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          ----------------------------------------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------------------------------------------
2g80A1          ----------------------------------------------------------------------
1svjA           ----------------------------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
1rlmA           ----------------------------------KVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIK
1iwoA4          ----------------------------------------------------------------------
1v93A           ----------------------------------------------------------------------
1rkqA           ----------------------------------KLIAIDMDGTLLLPDHTISPAVK-NAIAAARARGVN
1qwgA           ------------------------------------VVLDKGLPPKFVDYLKVCGDYID-----FVKFGW
1iwoA2          ----------------------------------------------------------------------
1v6tA           ---------------------------------------DLNSDLGES-FGRYKLGLDEEVMKYITSANV
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------KGIAFDLYGTLFDVH---------------------
1dioG           KVTAQPETLRLQASIAKDAGRDRLAMNFERAAELTAVPDDRILEIYNALRPYRST-------KEELLAIA
1te2A           ----------------------------------LAAIFDXDGLLIDSE---------------------
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           ----------------------------------RVFVFDLDGTLLNDNLEISEKDRRNIEKLSRKCYV-
2b0cA1          ----------------------------------------------------------------------
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          ---------------------------------------------------VTDLVPLNG-DERELLRLA
2go7A1          ----------------------------------TAFIWDLDGTLLDSY---------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------LLLISDLDNTWVGDQQALEHLQEYLGDRRGNF----
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------------
1iwoA1          ----------------------------------------------------------------------
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           ----------------------------------------------------------------------
1lplA           ----------------------------------------------------------------------
1a9xA2          ----------------------------------------------------------------------
1xviA           ------------------------------IQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPV
2bduA1          ----------------------------------------------------------------------
1aonO           ----------------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           ----------------------------------KAVLFXLDGVIT------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          ----------------------------------------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------TVILLDIEGTTTPIAFVKDILFPY---IEENVKEYL
2g80A1          ----------------------------------STYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQD
1svjA           ----------------------------------------------------SEFIPAQGVDEKTLADAA
1l8lA           ----------------------------------------------------------------------
1iwoA3          ------------------------------VCKMFIIDKVDGDFCSLNEFSITGSTYAP-----------
2fdrA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
1rlmA           FVVASGNQYYQLISFFPELDEISFVAENGALVYEHGFHGELTRHESRIVIGELLKDKQLNFVACGLQSAP
1iwoA4          ----------------------------------------------------------------------
1v93A           -------------------------FEFFPPKDPEGEEALFRTLEELKAFRPAFITYGAMGSTRERSVAW
1rkqA           VVLTTGRPYAGVHNYLKEITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHDRTTLYTANR
1qwgA           GTSAVIDRDVVKEKINYYKDWGIPGGTLFEYAYSKGKFDEFLNECEKLGFEAVEISDGSERNNAIKRAKD
1iwoA2          ----------------------------------------------------------------------
1v6tA           ACGWHAGDPLVMRKTVRLAK---ENDVQVGAHPGYPDLMGFGRRYMKLTPEEARNYILYQVGALYAFAKL
1np7A2          ----------------------------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ------SVVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATEDALRFTCRH--------L
1dioG           DDLESRYQAKICAAFVR-----------------------------------------------------
1te2A           --------PLWDRAELDSLGVDISRRNELPDTLGLRIDXVVDLWYARQP---------------WNGPSR
2feaA1          ----------------------------------------------------------------------
1owlA2          ----------------------------------------------------------------------
1nf2A           VFASGRMLVSTLNVEKKYFKRTFPTIAYNGAIVYLPEEGVILNEKIPPEVAKDIIEYIKPLNVHWQAYID
2b0cA1          -----------------------------SDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHE
1gdhA2          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
2b8eA2          AIAERRSEHPIAEAIVLEHGIELGEPEKVEVIAGEGVVADGIL----VGNKRLXEDFGVAALEKLEREAK
2go7A1          --------EAILSGIEETFAQFSIPYDKEKVREFIF------KYSVQDLLVRVAEDRNLD----------
2pjuA1          ---------------------SVTRLFELFRDISLEFDHLANITPIQLGFEKAVTYIRKKLANERCDAIG
2fi1A1          ----------------------------------------------------------------------
1s2oA1          YLAYATGRSYHS---ARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFE
1f5sA           ----------------------------------------------------------------------
1rkuA           ----------------------------------------------------------------MKQRLR
1iwoA1          ----------------------------------------------------------------------
1j49A2          ----------------------------------------------------------------------
2a0mA1          ----------------------------------------------------------------------
1j8dA           -------------------------------------------------NIKFV-ITDVDGV-----LTD
1lplA           ----------------------------------------------------------------------
1a9xA2          ----------------------------------------------------------------------
1xviA           ILC-SSKTSAEMLYLQKTLGLQGLPLIAENGAVIQLAEQWQEIDGFPRIISGISHGEISLVLNTLREKEH
2bduA1          ----------------------------------------------------------------------
1aonO           ----------------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           ---DTAEYHFRAWKALAEEIGNGVDRQFNEQLKGVSREDSLQK---------ILDLADKK--VSAEEFKE
2gmwA1          -----------------------------------AIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRG
1ymqA1          ----------------------------------------------------------------------
1g61A           --------------------------NEVSEVLETKCLQTNIGGSSLVGSLSVANKY---GLLLPKIVED
1dgsA2          ----------------------------------------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          QTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAAGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQ
2g80A1          TRDSPVDNKEQLQAHILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIYSSG
1svjA           QLASLADETPEGRSIVKQRFNLRERDVQSLHATFVPFTAQIDNRMIRKGSVDAIRRHDVDQVDQVARQGA
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
1rlmA           EAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQ-IPLVIDKLHVALDGIMKPVTSGFGFIDLIIP
1iwoA4          ------------AIVGVWQERNAENAIEALKEYEPAAT-EQDKTPLQQKLDEFGEQLSKVISLICVAVWL
1v93A           AQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVAL
1rkqA           DISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLKSAPYFLRV
1qwgA           NGFMVLTEVGKKMPDKDKQLTIDDRIKLINFDLDAGAD-YVIIEGRESGKGKGLFDKEGKVKENELDVLA
1iwoA2          ------------LTTNQLDPPRKEVMGSIQLCRDAGIR-VIMITGDNKGTAIAICRRIGIFGENEEVAPS
1v6tA           ELQHVKPHGALYNAMVKEEDLARAVIEGILDFDKDLIL-VTLSNSRVADIAEEMGLKV-AHEVFADRAYN
1np7A2          RQFAQTHQGFAKTGPWRSNFLQQSVQNLAESLQKVGNK-LLVTTGLPEQVIPQIAKQINAKTIYYHREVT
2b8eA1          KVTAVIFDKTGTLTKGKPDTLKESAKPAVQELKRXGI-KVGXITGDNWRSAEAISRELNLDLVIAEVLPH
1judA           GLDLDARTRSTLCDAYLRLAPFSEVPDSLRELKRRG-LKLAILSNGSPQSIDAVVSHAGLRDGFDHLLNR
1dioG           ----------------------------------------------------------------------
1te2A           QEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHXLEKVLTXFDLRDSFDALASAE
2feaA1          GLLPSSLKEEITSFVLEDAKIREGFREFVAFINEHEIP-FYVISGGXDFFVYPLLEGHSCKGTCSNQCGC
1owlA2          LIGLFCLDPQILQAPARVAYLQGCLQELQQRYQQAGS-RLLLLQGDPQHLIPQLAQQLQAEAVYWNQDIE
1nf2A           DVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELKEILSERFKDVVKVFNV
2b0cA1          MALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHR-VVVLSNTNRLHTTFWPEEYPEIRDAADHIAR
1gdhA2          --------------------TWPLPEAAMARARESYDV-IAHGDDPKITIDEMIETAKSVDALLITLNEK
1un8A1          ------------------------------------------ITCVVSSHASARVEFQPSNALVAGIVEL
2b8eA2          TAVIVARNGRVEGIIAVS----------------------------------------------------
2go7A1          VEVLNQVRAQSLAEKNAQVVLXPGAREVLAWADESGIQ-QFIYTHKGNNAFTILKDLGVESYFVRKPSPE
2pjuA1          SNGAYLKSRLSVPVILIKPSGYDVLQFLAKAGKLTSSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEE
2fi1A1          LENFLEKYKENEARELEHPILFEGVSDLLEDISNQGGR-HFLVSHRNDQVLEILEKTSIAAYSGFKRKPN
1s2oA1          ALKPQSPLEQNPWKISYHLDPQACPTVIDQLTE---MLKETGIPVQVIFSSGKDVDLLPQR--------S
1f5sA           VSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYV-VAVVSGGFDIAVNKIKEKLGLDYAFANRKGE
1rkuA           ILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVV--ILSDTFYEFSQPLMRQLGFPTLLCHKLEI
1iwoA1          ----------------------------------------------------------------------
1j49A2          --------------------IREDEKPFLKEWEDAHKD-VEVEYTDKLLTPETVALAKGADGVVVYQQLD
2a0mA1          -------------------VIGGGNDQNGRAMLRAFPGDVGVINVDSDVRPPLQDGRVHSGTPFRQLLEE
1j8dA           GQLHYDANGEAIKSFHVRDGL------GIKXLXDADIQ-VAVLSGRDSPILRRRIADLGIKLFFLGKL--
1lplA           ----------------------------------------------------------------------
1a9xA2          ----STMKKHGRALLSVREGDKERVVDLAAKLLKQ-GFELDATHGTAIVL-----GEAGINPRLVNKVHE
1xviA           --FKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLNELGLQFMQGARGKD
2bduA1          ------------EIVADSDVLKEGYENFFGKLQQHGIP-VFIFSAGIGDVLEEVIRQAGVYHSNVKVVKH
1aonO           ----------------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           LAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKI-KIALASASKNGPFLLERMNLTGYVAASKPAPD
2gmwA1          FALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEE-FRQVCDCRKPHPG
1ymqA1          ----------------------------------------------------------------------
1g61A           EELDRIKNFLKENNLDLNVEIIKSKNTALGNLILTNDKGA-LISPELKDFKKDIEDSLNVEVEIGTIAEL
1dgsA2          ----------------------------------------------------------------------
1kytA           ---------------------------------------------------------------------E
1wzcA1          ----------------------------------------------------------------------
1u2zA           ------------------------------------------------------------NYVYGELLPN
1xpjA           ---------QANTSDYRNVLPRLDVIEQLREYHQLGFE-IVISTARNMRTYEGNVGKINIHTLPIITEWL
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------FQELFEADEPIDFYNILGFSFFKEKLEAGWKRYEHAEDLTLVSSAEHNFELSSR
1ynsA1          GHMW----RAAFTAGRMKAEFFADVVPAVRKWREAGMK-VYIYSSGSVEAQKLLFGHSTEGDILELVDGH
2g80A1          SVKAQKLLFGYVQD----PNAPAHDSLDLNSYIDGYFDINTSGKKTETQSYANILRDIGA----------
1svjA           TPLVVVEGSRVLGVIALKDIVK------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK
1rlmA           HKANGISRLLKRWDLSPQNVAIGDSGNDAEMLKMARYSFAMGN-AAENIKQIARYATDDNNHEGALNVIQ
1iwoA4          INIGHFNDPVHGGS---WIRGAIYYFKIAVALAVAAIPEGLPAVTTCLALGTRRMAKKNAIVRSLPSVET
1v93A           IRERYG------DRVSVGGAAYPEGHPESESLEADLRHFKAKV-EAGLDFAITQLFFNNAHYFGFLERAR
1rkqA           NKGTGVKSLADVLGKPEEIMAIGDQENDIAMIEYAGVGVAVDN-AIPSVKEVANFVTKSNLEDGVAFAIE
1qwgA           KNVDINKVIFEAPQKSQQANIAFDEVISLETLRRGLRGDTFGKV--------------------------
1iwoA2          HKSKIVEYLQSY---DEITAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE
1v6tA           PDGTLVPAVIED----------KEEIAERVISMVKDGGIRAIN-GEWVDLKVDTICVHGDNPKA----VE
1np7A2          QEELDVERVKQLTILGIEAKGYWGSTLCHPEDLPFSIQDLPD-LFTKFRKDIEKKKISIRPCFFAPSQLL
2b8eA1          QKS----EEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGS---------GDIVLIRDDLRDVVAAIQ
1judA           VYELAEQALGL---DRSAILFVSSNAWDATGARYFGFPTCWTGNVFEEMGQTPDWEV-------------
1dioG           ----------------------------------------------------------------------
1te2A           KLPYSLDCAAKLGVDPLTCVALEDSVNGXIASKAARIVVPAPEAQNDPRFVLANVKL--SSLTELTAKDL
2feaA1          CKPSVIHELS---EPNQYIIXIGDSVTDVEAAKLSDLCFAR-DYLLNECREQNLNHLPYQDFYEIRKEIE
1owlA2          PRDRDGQVAAALKTAGIRAVQLWDQLLHSPDQILSGSGNPYS-VYGPFWKNWQAQ--PKPTPVATPTELV
1nf2A           DKGKALRFLRERMNWKKEIVVFGDNENDLFMFEEAGLRVAMEN-AIEKVKEASDIVTLTNNDSGVSYVLE
2b0cA1          IYQHVLQAEGF---SPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV---------------
1gdhA2          CRKEVIDRIPENIK---CISTYSIGFDHIDLDACKARGIKVGNAPHGATQAREDMAHQANDLIDALFGGA
1un8A1          VTATLSDLETHL---NALDAKVGDG----------DTGSTFAAAAREIASLLHRQQLPLNNLATLFALIG
2b8eA2          ----------------------------------------------------------------------
2go7A1          AATYLLDKYQL---NSDNTYYIGDRTLDVEFAQNSGIQSINFLESTYEGNHRIQAL--------------
2pjuA1          DARGQINELKANGTEA--VVGAGLITDLAEEAGMTGIFIYSAA-TVRQAFSDALDMT-------------
2fi1A1          PESMLYLREKY---QISSGLVIGDRPIDIEAGQAAGLDTHLFT-SIVNLRQVLDI---------------
1s2oA1          NKGNATQYLQQHLAMEPSQLVCGDSGNDIGLFETSARGVIVRN-AQPELLHWYDQWGDSRHYRAQSS---
1f5sA           ILEKIAKIEGIN---LEDTVAVGDGANDISMFKKAGLKIAFC--AKPILKEKADICIEKRDLREILKYIK
1rkuA           DDSDRRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHA-PENVIREFPQFPAVHTYEDLKREFLK
1iwoA1          ----------------------------------------------------------------------
1j49A2          YIAETLQALADN--GITKMSLRNVGVDNIDMAKAKELGFQITN-VPVYSYTTHAVRNM-----VVKAFDN
2a0mA1          SSFSGKRFVEFACQ---GSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAAFSFDVDSLKSSDMPGVSCPA
1j8dA           EKETACFDLXKQAGTAEQTAYIGDDSVDLPAFAACGTSFAVAD-APIYVKNAVDHVLST-----------
1lplA           ----------------------------------------------------------------------
1a9xA2          GRPHIQDRIK----NGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGFAT------------
1xviA           QAANWIIATYQQLSGKRTTLGLGDGPNDAPLLEVMDYAVIVK----------------------------
2bduA1          DGALKNTDYFSQLKDNSNIILLGDSQGDADGVANVEHILKIGYLNDRVYXDSYDIVLVKEESLEVVNSI-
1aonO           ----------------------------------------------------------------------
2b30A1          -KYTGINYLLKHYNSNDQVLVVGDAENDIAMLSNFKYSFAVAN-ATDSAKSHAKCVLPVSHRGAVAYLLK
1lvhA           IFIAAAHAVGV---APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLIVIVPDTSH--YTLEFLKEVWL
2gmwA1          MLLSARDYLHI---DMAASYMVGDKLEDMQAAVAANVGTKVGKPITPEAENAADWVL--NSLADLPQAIK
1ymqA1          TKQKGIDEIIRHFGIKLETMSFGDGGNDISMLRHAAIGVAMGQ-AKEDVKAAADYVTAPIDEDGISKAMK
1g61A           PTVGSNAVVTNKGCEYIGKGTANKGTTSVGASKGAVVGGDTTG-PELLIIEDALG---------------
1dgsA2          ----------------------------------------------------------------------
1kytA           DKAFAVNKLKEXYSEYDEILVIGDSNNDXPXFQLPVRKACPA-NATDNIKAVSDFVSDYSYGEEIGQIFK
1wzcA1          DKGKAAKILLDFYKRLGQSYAVGDSYNDFPMFEVVDKVFIVGSLKHKKAQNVSSII--------------
1u2zA           FLSDVYQQCQLKKGDT--FMDLGSGVGNCVVQAALECGCAL-SFGCEIMDDASDLTIL------------
1xpjA           DKHQVPYDDDRAVRPSEFASMNLEEIHQLFEKE-------------------------------------
1wr8A           NKGSGIEKASEFLGKPKEVAHVGDGENDLDAFKVVGYKVAVAQ-APKILKENADYVTKKEYGEGGAEAI-
1zq1A1          ----------------------------------------------------------------------
1nrwA           SKGQALKRLAKQLNPLEETAAVGDSLNDKSXLEAAGKGVAXGN-AREDIKSIADAVTLTND---------
1ynsA1          FDTKIGHKVESESYSTNNILFLTDVTREASAAEEADVHVAV-----------------------------
2g80A1          --------------KASEVLFLSDNPLELDAAAGVGGLASRPG-NAPVPDGQKYQVY-------------
1svjA           ----------------------------------------------------------------------
1l8lA           -------------FHFKKIIMIGDGATDMEACPPADAFIGFGGVIRQQVKDNAKWYI--TDFVELLGELE
1iwoA3          ----------------------------------------------------------------------
2fdrA1          --------------SPDRVVVVEDSVHGIHGARAAGXRVIGF-TGASHTYPSHADRLTDAGAETV-----


                         .         .         .         *         .         .         .:630
query           IARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAILNALRLLKMKEENKKINKYPH
1rlmA           ----------------------------------------------------------------------
1iwoA4          LGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVPATALGFNPPDLDIMDRPPR
1v93A           RA--------------------------------------------------------------------
1rkqA           ----------------------------------------------------------------------
1qwgA           ----------------------------------------------------------------------
1iwoA2          ----------------------------------------------------------------------
1v6tA           ITSYIRKVLEEE----------------------------------------------------------
1np7A2          PSPNIKLELTAPPPEFF-----------------------------------------------------
2b8eA1          ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1dioG           ----------------------------------------------------------------------
1te2A           ----------------------------------------------------------------------
2feaA1          NVKEVEWL--------------------------------------------------------------
1owlA2          DLSPEQLTAIAPLLLSELPTLK-----QLGFDWD------------------------------------
1nf2A           ----------------------------------------------------------------------
2b0cA1          ----------------------------------------------------------------------
1gdhA2          DMSYA-----------------------------------------------------------------
1un8A1          ERLTVVMIFFTAAGQKLEQGANVVEALNTGLAQMKFYGGADEG---------------------------
2b8eA2          ----------------------------------------------------------------------
2go7A1          ----------------------------------------------------------------------
2pjuA1          ----------------------------------------------------------------------
2fi1A1          ----------------------------------------------------------------------
1s2oA1          ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1rkuA           ASSRS-----------------------------------------------------------------
1iwoA1          ----------------------------------------------------------------------
1j49A2          NLEL---VEGKEAETPVKV---------------------------------------------------
2a0mA1          AVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVEEYRSPRVAVYM--FYHFVLGFATR-----------
1j8dA           ----------------------------------------------------------------------
1lplA           ----------------------------------------------------------------------
1a9xA2          ----------------------------------------------------------------------
1xviA           ----------------------------------------------------------------------
2bduA1          ----------------------------------------------------------------------
1aonO           ----------------------------------------------------------------------
2b30A1          ----------------------------------------------------------------------
1lvhA           QKQK------------------------------------------------------------------
2gmwA1          ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------
1g61A           ----------------------------------------------------------------------
1dgsA2          ----------------------------------------------------------------------
1kytA           ----------------------------------------------------------------------
1wzcA1          ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1zq1A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ynsA1          ----------------------------------------------------------------------
2g80A1          ----------------------------------------------------------------------
1svjA           ----------------------------------------------------------------------
1l8lA           ----------------------------------------------------------------------
1iwoA3          ----------------------------------------------------------------------
2fdrA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SKTExxxxxxxxx
1rlmA           -------------
1iwoA4          SPKE---------
1v93A           -------------
1rkqA           -------------
1qwgA           -------------
1iwoA2          -------------
1v6tA           -------------
1np7A2          -------------
2b8eA1          -------------
1judA           -------------
1dioG           -------------
1te2A           -------------
2feaA1          -------------
1owlA2          -------------
1nf2A           -------------
2b0cA1          -------------
1gdhA2          -------------
1un8A1          -------------
2b8eA2          -------------
2go7A1          -------------
2pjuA1          -------------
2fi1A1          -------------
1s2oA1          -------------
1f5sA           -------------
1rkuA           -------------
1iwoA1          -------------
1j49A2          -------------
2a0mA1          -------------
1j8dA           -------------
1lplA           -------------
1a9xA2          -------------
1xviA           -------------
2bduA1          -------------
1aonO           -------------
2b30A1          -------------
1lvhA           -------------
2gmwA1          -------------
1ymqA1          -------------
1g61A           -------------
1dgsA2          -------------
1kytA           -------------
1wzcA1          -------------
1u2zA           -------------
1xpjA           -------------
1wr8A           -------------
1zq1A1          -------------
1nrwA           -------------
1ynsA1          -------------
2g80A1          -------------
1svjA           -------------
1l8lA           -------------
1iwoA3          -------------
2fdrA1          -------------