[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00490.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ui5A1.bssp"
#ERROR : Can't open dsspfile "2fbqA1.bssp"
#ERROR : Can't open dsspfile "2iu5A1.bssp"
#ERROR : Can't open dsspfile "2hyjA1.bssp"
#ERROR : Can't open dsspfile "2g7sA1.bssp"
#ERROR : Can't open dsspfile "2g3bA1.bssp"
#ERROR : Can't open dsspfile "2g7lA1.bssp"
#ERROR : Can't open dsspfile "1a6iA1.bssp"
#ERROR : Can't open dsspfile "1z77A1.bssp"
#ERROR : Can't open dsspfile "1v7bA1.bssp"
#ERROR : Can't open dsspfile "2fq4A1.bssp"
#ERROR : Can't open dsspfile "1sgmA1.bssp"
#ERROR : Can't open dsspfile "1rktA1.bssp"
#ERROR : Can't open dsspfile "1zk8A1.bssp"
#ERROR : Can't open dsspfile "3c07A1.bssp"
#ERROR : Can't open dsspfile "2np5A1.bssp"
#ERROR : Can't open dsspfile "2fd5A1.bssp"
#ERROR : Can't open dsspfile "1t56A1.bssp"
#ERROR : Can't open dsspfile "1vi0A1.bssp"
#ERROR : Can't open dsspfile "2i10A1.bssp"
#ERROR : Can't open dsspfile "2hkuA1.bssp"
#ERROR : Can't open dsspfile "2genA1.bssp"
#ERROR : Can't open dsspfile "2oi8A1.bssp"
#ERROR : Can't open dsspfile "1pb6A1.bssp"
#ERROR : Can't open dsspfile "2np3B1.bssp"
#ERROR : Can't open dsspfile "1jt0A1.bssp"
#ERROR : Can't open dsspfile "2o7tA1.bssp"
#ERROR : Can't open dsspfile "2id3A1.bssp"
#ERROR : Can't open dsspfile "2g7gA1.bssp"
#ERROR : Can't open dsspfile "1t33A1.bssp"
#ERROR : Can't open dsspfile "2d6yA1.bssp"
#ERROR : Can't open dsspfile "2gfnA1.bssp"

## Summary of PDB Search
:197
    3e-14  31%  1ui5A1 [a.4.1.9] A-FACTOR RECEPTOR HOMOLOG A:5 -- 75
    8e-14  23%  2fbqA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 80
    1e-13  26%  2iu5A1 [a.4.1.9] HYPOTHETICAL PROTEIN YCEG A:1 -- 71
    1e-13  18%  2hyjA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-13  18%  2g7sA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:3 -- 76
    3e-13  29%  2g3bA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-13  11%  2g7lA1 [a.4.1.9] TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:16 -- 83
    3e-13  29%  1a6iA1 [a.4.1.9] TETRACYCLINE REPRESSOR PROTEIN CLASS D A:2 -- 67
    3e-13  26%  1z77A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:1 --
    4e-13  21%  1v7bA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 74
    7e-13  25%  2fq4A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:9 -- 77
    7e-13  16%  1sgmA1 [a.4.1.9] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YXAF
    9e-13  22%  1rktA1 [a.4.1.9] PROTEIN YFIR A:2 -- 82
    9e-13  21%  1zk8A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:6 -- 77
    1e-12  23%  3c07A1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-12  17%  2np5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:9 -- 77
    2e-12  29%  2fd5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 76
    4e-12  20%  1t56A1 [a.4.1.9] ETHR REPRESSOR A:22 -- 94
    4e-12  33%  1vi0A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:6 -- 77
    5e-12  19%  2i10A1 [a.4.1.9] PUTATIVE TETR TRANSCRIPTIONAL REGULATOR A:10 --
    1e-11  22%  2hkuA1 [a.4.1.9] A PUTATIVE TRANSCRIPTIONAL REGULATOR A:18 -- 87
    1e-11  23%  2genA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:6 -- 75
    1e-11  24%  2oi8A1 [a.4.1.9] PUTATIVE REGULATORY PROTEIN SCO4313 A:8 -- 86
    2e-11  19%  1pb6A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YCDC A:14
    2e-11  24%  2np3B1 [a.4.1.9] PUTATIVE TETR-FAMILY REGULATOR B:35 -- 99
    5e-11  24%  1jt0A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA
    5e-11  22%  2o7tA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 78
    1e-10  25%  2id3A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REGULATOR A:13 -- 80
    8e-10  20%  2g7gA1 [a.4.1.9] RHA04620, PUTATIVE TRANSCRIPTIONAL REGULATOR A:9
    9e-10  21%  1t33A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REPRESSOR (TETR/ACRR
    1e-06  23%  2d6yA1 [a.4.1.9] PUTATIVE TETR FAMILY REGULATORY PROTEIN A:7 --
    5e-05  20%  2gfnA1 [a.4.1.9] HTH-TYPE TRANSCRIPTIONAL REGULATOR PKSA RELATED
:197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
1ui5A1          -----LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILEIQSRTSR
2fbqA1          ---------ETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFC
2iu5A1          ------KSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELI
2hyjA1          ------EAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFW
2g7sA1          --------QSKADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIHHHFPSKSDLVCKLVSQYRQEAE
2g3bA1          ---------ERRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRAR
2g7lA1          ------KPALSRRWIVDTAVALXRAEGLEKVTXRRLAQELDTGPASLYVYVANTAELHAAVLDALLGEVD
1a6iA1          --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARHH
1z77A1          ----------KRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYXSVTEKLQ
1v7bA1          --------TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWD
2fq4A1          ------RNIETQKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVVXDGFLSAAAARL
1sgmA1          ----------SREKILHTASRLSQLQGYHATGLNQIVKESGAPKGSLYHFFPNGKEELAIEAVTYTGKIV
1rktA1          ------HKDKRQAEILEAAKTVFKRKGFELTTXKDVVEESGFSRGGVYLYFSSTEEXFRRIIETGLDEGL
1zk8A1          -------IGLTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLGIYGIKKLH
3c07A1          ------KSEQTRALILETAXRLFQERGYDRTTXRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEHR
2np5A1          ----------SPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHFSTKDEXFAFALRTLVDKLL
2fd5A1          ------KKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEA---------
1t56A1          ---------DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQAD
1vi0A1          -----------YXQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKXGQFI
2i10A1          -----------DQVALQTAXELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYXCERT
2hkuA1          ---------QTRDALFTAATELFLEHGEG-VPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAG
2genA1          -----------KDEILQAALACFSEHGVDATTIEXIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYA
2oi8A1          ------YRTQVRAEIKDHAWEQIATAGASALSLNAIAKRXGXSGPALYRYFDGRDELITELIRDAYRSQA
1pb6A1          -----------------AALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWL
2np3B1          --------------ILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIEE
1jt0A1          ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEI---------
2o7tA1          --------LKRREHIITTTCNLYRTHHHDSLTXENIAEQAGVGVATLYRNFPDRFTLDXACAQYLFNVVI
2id3A1          ------RTARIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGTPGGLAADL---------
2g7gA1          ----------DRERIAEAALELVDRDGD--FRXPDLARHLNVQVSSIYHHAKGRAAVVELVRHRVVREID
1t33A1          ------KGEQAKSQLIAAALAQFGEYGL-HATTRDIAALAGQNIAAITYYFGSKEDLYLACAQWIADFLG
2d6yA1          ---------ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKXLDLA
2gfnA1          ---------ERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELL------------


                         .         .         *         .         .         .         .:140
query           QLFHDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ui5A1          RLAKD-----------------------------------------------------------------
2fbqA1          ASL-------------------------------------------------------------------
2iu5A1          NDNSD-----------------------------------------------------------------
2hyjA1          HRV-------------------------------------------------------------------
2g7sA1          AGI-------------------------------------------------------------------
2g3bA1          AYRSE-----------------------------------------------------------------
2g7lA1          L---------------------------------------------------------------------
1a6iA1          D---------------------------------------------------------------------
1z77A1          KEFEN-----------------------------------------------------------------
1v7bA1          KELRD-----------------------------------------------------------------
2fq4A1          PVP-------------------------------------------------------------------
1sgmA1          E---------------------------------------------------------------------
1rktA1          RKL-------------------------------------------------------------------
1zk8A1          NRL-------------------------------------------------------------------
3c07A1          AAVRE-----------------------------------------------------------------
2np5A1          ARLSE-----------------------------------------------------------------
2fd5A1          ----------------------------------------------------------------------
1t56A1          MALQT-----------------------------------------------------------------
1vi0A1          E---------------------------------------------------------------------
2i10A1          LQL-------------------------------------------------------------------
2hkuA1          KRA-------------------------------------------------------------------
2genA1          ALLEA-----------------------------------------------------------------
2oi8A1          DSL-------------------------------------------------------------------
1pb6A1          APLKA-----------------------------------------------------------------
2np3B1          AIT-------------------------------------------------------------------
1jt0A1          ----------------------------------------------------------------------
2o7tA1          SL--------------------------------------------------------------------
2id3A1          ----------------------------------------------------------------------
2g7gA1          G---------------------------------------------------------------------
1t33A1          EKF-------------------------------------------------------------------
2d6yA1          I---------------------------------------------------------------------
2gfnA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ui5A1          ---------------------------------------------------------
2fbqA1          ---------------------------------------------------------
2iu5A1          ---------------------------------------------------------
2hyjA1          ---------------------------------------------------------
2g7sA1          ---------------------------------------------------------
2g3bA1          ---------------------------------------------------------
2g7lA1          ---------------------------------------------------------
1a6iA1          ---------------------------------------------------------
1z77A1          ---------------------------------------------------------
1v7bA1          ---------------------------------------------------------
2fq4A1          ---------------------------------------------------------
1sgmA1          ---------------------------------------------------------
1rktA1          ---------------------------------------------------------
1zk8A1          ---------------------------------------------------------
3c07A1          ---------------------------------------------------------
2np5A1          ---------------------------------------------------------
2fd5A1          ---------------------------------------------------------
1t56A1          ---------------------------------------------------------
1vi0A1          ---------------------------------------------------------
2i10A1          ---------------------------------------------------------
2hkuA1          ---------------------------------------------------------
2genA1          ---------------------------------------------------------
2oi8A1          ---------------------------------------------------------
1pb6A1          ---------------------------------------------------------
2np3B1          ---------------------------------------------------------
1jt0A1          ---------------------------------------------------------
2o7tA1          ---------------------------------------------------------
2id3A1          ---------------------------------------------------------
2g7gA1          ---------------------------------------------------------
1t33A1          ---------------------------------------------------------
2d6yA1          ---------------------------------------------------------
2gfnA1          ---------------------------------------------------------