[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00499.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "2r6gF2.bssp"

## Summary of PDB Search
:342
    4e-27  11%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    1e-14   9%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
    3e-14  16%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    2e-13  19%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-04  14%  2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
:342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
2r6gF2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKYFYLGTDYLGRSLAQRIIYGT
2r6gG1          -----------------------------------------------DHWKLALGFSVITPPPFPVLLWL
1tluA           ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------FNFDEFLKAASDPVWKVV
3dhwA1          ----------------------------------------------------------------LLVRGV
2r6gF2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVSLIVALVATFFDLTVGVAYGIISGWKGGRVDNVMQRIIEIISSIPNXXXXXXXXXXXKPGMTSIILAI
2r6gG1          WNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRNTHGGVIFA
1tluA           -----------------------------------------------------------------SLGRH
2onkC1          LTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSALPGIVVAM
3dhwA1          WETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLSIGLQAAIVPL
2r6gF2          -------------------------------------------------------------ARTMLIIVN


                         .         .         .         +         .         .         .:280
query           AISSWTTMARMIRAETLSLKTQEYVLAARTLGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLS
2r6gG1          YLGGIALHVWTIKGYFETID-SSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVAS
1tluA           LVAEFYECDREVLDNVQLIE-QEMKQAAYESGATIVTSTFHRFLPYGVSGVVVISESHLTIHTWPEYGYA
2onkC1          LFVSVPIYINQAKE-GFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAVV
3dhwA1          TVGAAPFIARMVEN-ALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGG
2r6gF2          TWLGYPYMMILCMGLLKAIP-DDLYEASAMDGAGPFQNFFKITLPPLTPLMIASFAFN------FNNFVL


                         .         *         .         .         .         .         +:350
query           FIGIGITAPETSLGVLLNEGQKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFxxxxxx
2r6gG1          LLLRDVNSYTLAVGMQQYLNPQNYLWGDF-AAAAVMSALPITIVFLLAQRWLVNGL------
1tluA           AIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI--------------------
2onkC1          VIAYYPMIAPTLIY-----ERYLSEGLSAAMPVAAILILLSLAVF-----------------
3dhwA1          AVGAG---------------------------------------------------------
2r6gF2          IQLLTNGGPDRLGTTTPAG---YTDLLVNYTYRIAFE-------------------------