[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABE00528.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b79A.bssp"
#ERROR : Can't open dsspfile "1n0wA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1g18A1.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1nbaA.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"

## Summary of PDB Search
:463
    1e-34  47%  1b79A  [a.81.1.1] DNAB HELICASE
    3e-28  15%  1n0wA  [c.37.1.11] DNA REPAIR PROTEIN RAD51 HOMOLOG 1
    6e-22  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    4e-19  15%  1g18A1 [c.37.1.11] RECA PROTEIN A:3 -- 269
    6e-15  17%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    3e-09  13%  1nbaA  [c.33.1.3] N-CARBAMOYLSARCOSINE AMIDOHYDROLASE
    3e-05   9%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
:463

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
1b79A           ----------PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
1n0wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1g18A1          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------
1nbaA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEExxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b79A           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRE----------------------------
1n0wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1g18A1          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------
1nbaA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
1b79A           ----------------------------------------------------------------------
1n0wA           ------------------------------------------EIIQITTGSKELDKLLGGIETGSITEXF
1cr0A           ---------------------------------IREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVT
1g18A1          -TPDREKALELAVAQIEKSYGKG--------SVMRLGDEARQPISVIPTGSIALDVAIGGLPRGRVIEIY
1tf7A1          ---------------------------------------EHQAIAKMRTMIEGFDDISGGLPIGRSTLVS
1nbaA           ----------------------------------------------------------------------
1oftA           -----------------------------------------------------------------SELSL


                         .         .         .         +         .         .         .:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
1b79A           ----------------------------------------------------------------------
1n0wA           GEFRTGKTQICHTLAVTCQLP---------IDRGGGEGKAXYIDTEGTFRPERLLAV------AERYGLS
1cr0A           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFWFD
1g18A1          GPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKL-----GVDTDSLLVSQPDTGELEIADML
1tf7A1          GTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNAR-SFGWDLAKLVDEGKLFILDA------
1nbaA           ----------------------------------------------------------------------
1oftA           SGLPGHCLTLLAPILRELEEQDARWLTLIAPPASLTHEWLRRAG----LNRERILLLQAKDNAAALALSC


                         .         *         .         .         .         .         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
1b79A           ----------------------------------------------------------------------
1n0wA           GSDVLDNVAYARAFNTDHQTQLLYQASAXXVESRYALLIVDSATALY--RELSARQXHLARFLRXLLRLA
1cr0A           ELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLG-CDVIILDHISI---------RKMIDNLMTKLKGFA
1g18A1          IRSGALDIVVIDSVAALVPRAELE-----------------------GEMHVGLQARLMSQALRKMTGAL
1tf7A1          ----SPDPEGQEVVGGFDLSALIERINY-AIQKYRARRVSIDSVTSVFQQ--YDASSVVRRELFRLVARL
1nbaA           IEARLAAVLEEAFEAGTSIYNERGFKRRIGYGN-RPAVIHIDLANAWTQPGHPPGMETIIPNVQRINEAA
1oftA           EALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRL----------------------------


                         .         .         .         .         *         .         .:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
1b79A           ----------------------------------------------------------------------
1n0wA           DEFGVAVVITNAHASTTRLYLRKGRGETRIKIYDSPCLPEAEAXFAINADGVG-----------------
1cr0A           KSTGVVLVVICHL-----------------KDLRALRQLSDTIIALERNQLVLVRILKCRFTGD------
1g18A1          NNSGTTAIFINQLTGGLKFYASVR---MDVRRVETLKDGTNAVGNRTR----------------------
1tf7A1          KQIGATTVMTTERIEEYG----------PIARYGVEEFVSD--NVVILRNVLEGERRRR-----------
1nbaA           RAKGVPVFYTTNVYR-------------------------------------------------------
1oftA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QDVGEVELIIEKNRAGARGTVKLLFxxxxxxxxxxxxxxxxxx
1b79A           -------------------------------------------
1n0wA           -------------------------------------------
1cr0A           -------------------------------------------
1g18A1          -------------------------------------------
1tf7A1          ------TLEILKLRGTSHMKGEYPF------------------
1nbaA           -------------------------------------------
1oftA           -------------------------------------------