[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56724.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h4kX.bssp"
#ERROR : Can't open dsspfile "1e0cA.bssp"
#ERROR : Can't open dsspfile "1uarA.bssp"
#ERROR : Can't open dsspfile "3hwiA.bssp"
#ERROR : Can't open dsspfile "3hwiB.bssp"
#ERROR : Can't open dsspfile "3hzuA.bssp"
#ERROR : Can't open dsspfile "1ora-.bssp"
#ERROR : Can't open dsspfile "1urhA.bssp"
#ERROR : Can't open dsspfile "1rhsA.bssp"
#ERROR : Can't open dsspfile "1boiA.bssp"
#ERROR : Can't open dsspfile "1rhdA.bssp"
#ERROR : Can't open dsspfile "1urhB.bssp"
#ERROR : Can't open dsspfile "1okgA.bssp"
#ERROR : Can't open dsspfile "2eg4A.bssp"
#ERROR : Can't open dsspfile "3d1pA.bssp"
#ERROR : Can't open dsspfile "1yt8A.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"
#ERROR : Can't open dsspfile "2kl3A.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"

## Summary of PDB Search
:270
    8e-62  44%  1h4kX  [c.46.1 - c.46.1] SULFURTRANSFERASE
    2e-59  44%  1e0cA  [c.46.1 - c.46.1] SULFURTRANSFERASE
    7e-37  39%  1uarA  [c.46.1 - c.46.1] RHODANESE
    4e-33  32%  3hwiA  [x.x.x] THIOSULFATE SULFURTRANSFERASE
    2e-31  32%  3hwiB  [x.x.x] THIOSULFATE SULFURTRANSFERASE
    5e-27  35%  3hzuA  [x.x.x] THIOSULFATE SULFURTRANSFERASE SSEA
    1e-25  30%  1ora-  [x.x.x] OXIDIZED RHODANESE
    8e-24  29%  1urhA  [c.46.1 - c.46.1] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE
    2e-23  29%  1rhsA  [c.46.1 - c.46.1 (1dp2A)] SULFUR-SUBSTITUTED RHODANESE
    2e-23  29%  1boiA  [x.x.x] RHODANESE
    5e-23  29%  1rhdA  [x.x.x] RHODANESE
    3e-22  29%  1urhB  [c.46.1 - c.46.1] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE
    3e-08  27%  1okgA  [c.46.1 - c.46.1 - d.26.1] POSSIBLE 3-MERCAPTOPYRUVATE
    7e-07  30%  2eg4A  [x.x.x] PROBABLE THIOSULFATE SULFURTRANSFERASE
    2e-06  35%  3d1pA  [x.x.x] PUTATIVE THIOSULFATE SULFURTRANSFERASE YOR285W
    1e-04  30%  1yt8A  [x.x.x] THIOSULFATE SULFURTRANSFERASE
    7e-04  26%  1qxnA  [c.46.1] SULFIDE DEHYDROGENASE
    0.001  32%  2kl3A  [x.x.x] ALR3790 PROTEIN
    0.001  30%  1qxnA  [c.46.1] SULFIDE DEHYDROGENASE(query 6->123)
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
1h4kX           -ASLPLVIEPADLQARLSAPELILVDLTSAARYAEGHIPGARFVDPKRTXXXXXXXXXXXXXREQLESLF
1e0cA           -ASLPLVIEPADLQARLSAPELILVDLTSAARYAEGHIPGARFVDPKRTXXXXXXXXXXXXXREQLESLF
1uarA           ----------DPKVRVLEDEDILLYDTG--------HIPGAQKIDWQRDFW--DPVVRDFISEEEFAK-L
3hwiA           -----VLVSADWAESNLHAPKVVFVEVDEDTSAYDRHIAGAIKLDWR--TDLQDPVKRDFVDAQQFSKLL
3hwiB           -----VLVSADWAESNLHAPKVVFVEVDEDTSAYDRHIAGAIKLDWR--TDLQDPVKRDFVDAQQFSKLL
3hzuA           ------------------DEDVLLYDVG--------HIPGAVKIDW-HTDLNDPRVRDYINGE-QFAELM
1ora-           ----------------------------ARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
1urhA           ----------DWLAEHIDDPEIQIIDAGQEDEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAM
1rhsA           ----------------------------ARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
1boiA           ----------------------------ARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
1rhdA           ----------------------------ARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
1urhB           ----------DWLAEHIDDPEIQIIDAGQEDEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAM
1okgA           -----VFLDPSEVADHLAEYRIVIKDHGSIQ-YAKEHVKSAIRADVDTNLSKLVPTSTALPPAEFIDWCA
2eg4A           -------------------EDAVLVDTRPRPAYEAGHLPGARHLDLSAPXXXXXXXXXXXXXXXXXXXXF
3d1pA           ----------------------------------------------------------------------
1yt8A           -------IDPTTLADWLGEPGTRVLDFTASANYAKRHIPGAAWVLRS-----------------QLKQAL
1qxnA           ----------------------------------------------------------------------
2kl3A           ------------------EPAFTILDVRDRSTYNDGHIMGAM----------------AMPIEDLVDRAS
1qxnA           -----VMLSPKDAYKLLQENDITLIDVRDPDELKAMGKPDVKN--YKHM------------SRGKLEPLL


                         .         .         *         .         .         .         .:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRY
1h4kX           GELGHRPEAVYVVYDDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPLS--RELPAPAGGPVAL
1e0cA           GELGHRPEAVYVVYDDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPLS--RELPAPAGGPVAL
1uarA           ERLGISNDTTVVLYGDKNNWWAAYAFWFFKYNGHKDVRL-NGGRQKWVEEGRPLTTEVPSYPPGRYEVPY
3hwiA           SERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASP
3hwiB           SERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASP
3hzuA           DRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAEETTLDVPTKTCTGYPVVQRN
1ora-           GSLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATL
1urhA           RELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAF
1rhsA           GSLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATL
1boiA           GSLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATL
1rhdA           GSLGISNDTHVVVYNGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATL
1urhB           RELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAF
1okgA           NGAGELP---VLCYDDECGAGGCRLWW-LNSLGADAY-VINGGFQA-----CKAAGLEESGEPSSLPATH
2eg4A           QTLGL--RSPVVLYD---EGLTSRLCRTAFFLGL-------GGLEVQLWTEG--WEPYAXXXXXXXXXXX
3d1pA           ----------------------------------------------------------------------
1yt8A           ERLG-TAERYVLTCGSSLLARFA--VAEVQALSGKPVFLLDGGTSAWVAAGLPTEDG-------------
1qxnA           ----------------------------------------------------------------------
2kl3A           SSLEKSRDIYV--YGA-GDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEGIIESRTPA------
1qxnA           AKSGLDPEKPVVVF-CKTAARAALAGKTLREYGFKTIYNSEGGMDKWLEEGLP-----------------


                         +         .         .         .         .         *         .:210
query           QGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
1h4kX           SLHDTASRDYLLGRLGAADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALRIRT--DI
1e0cA           SLHDTASRDYLLGRLGAADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALRIR--TDI
1uarA           RDESIAYRDDVLEHIIEGKGALVDVRSPQEYRGELEGALRAGHIPGAKNIPWAKAVNPDGT--FKSAEEL
3hwiA           PDNTRAFRDEVLAAINVKN--LIDVRSPDEFSGKILAPQRPGHIPGAINVPWSRAANEDGT--FKSDEEL
3hwiB           PDNTRAFRDEVLAAINVKN--LIDVRSPDEFSGKILAPQRPGHIPGAINVPWSRAANEDGT--FKSDEEL
3hzuA           DAPIRAFRDDVLAIL--GAQPLIDVRSPEEYTGKRTHALRAGHIPTAVHIPWGKAADESG--RFRSREEL
1ora-           NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNMPFMNFLTEDG--FEKSPEEL
1urhA           NPEAVVKVTDVLLASHENTAQIIDARPAARFNAE-VDELRRGHIPGALNVPWTELV---REGELKTTDEL
1rhsA           NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNMPFMNFLTEDG--FEKSPEEL
1boiA           NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNMPFMNFLTEDG--FEKSPEEL
1rhdA           NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNMPFMDFLTE--NGFEKSPEEL
1urhB           NPEAVVKVTDVLLASHENTAQIIDARPAARFNAR-------GHIPGALNVPWTELV---REGELKTTDEL
1okgA           WPFKTAFQHHYLVDEIPPQAIITDARS-ADRFASTVRADKPGHIEGARNLPYTSHLVTRGDGKLRSEEEI
2eg4A           XXXAKLRRDWLLADEAARHPLLLDVRSPEEFQGK-------------VHXXXXXXXXXXXXSKNAPLELF
3d1pA           QSYSFEDKRIVGKH--DPNVVLVDVREPSEYSIV--------HIPASINVPYRSHPDAFA------LDPL
1yt8A           ----------------------------------------------------------------------
1qxnA           -----------------------------------------------------------KNYKHMSRGKL
2kl3A           ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV
1h4kX           AGRLEELGITPDKEIVTHCQTHHRSGLTYLIAKALGYPRVKGYAGSWGEWGNHPDTPVEL
1e0cA           AGRLEELGITPDKEIVTH-QTHHRSGLTYLIAKALGYPRVKGYAGSWGEWGNHPDTPVEL
1uarA           RALYEPLGITKDKDIVVY-RIAERSSHSWFVLKYLGYPHVKNYDGSWTEWGNLVGVPI--
3hwiA           AKLYADAGLDNSKETIAYCRIGERSSHTWFVLRLLGHQNVKNYDGSWTEYGSLVGAPIEL
3hwiB           AKLYADAGLDNSKETIAYCRIGERSSHTWFVLRLLGHQNVKNYDGSWTEYGSLVGAPIEL
3hzuA           ERLYDF--INPDDQTVVYCRIGERSSHTWFVLTHLGKADVRNYDGSWTEWGNAVRVPI--
1ora-           RAMFEAKKVDLTKPLIATCRKGVTACHIALAAYLCGKPDVAIYDGSWFEW----------
1urhA           DAIFFGRGVSYDKPII-VSGSGXXXXXXXXXXXXXXXPNVKLYDGAWSE-----------
1rhsA           RAMFEAKKVDLTKPLIA-TRKGVTACHIALAAYLCGKPDVAIYDGSWFEW----------
1boiA           RAMFEAKKVDLTKPLIA-TRKGVTACHIALAAYLCGKPDVAIYDGSWFEW----------
1rhdA           RAMFEAKKVDLTKPLIA-TRKGVTACHIALAAYLCGKPDVAIYDGSWFEW----------
1urhB           DAIFFGRGVSYDKPII-VSGSGXXXXXXXXXXXXXXXPNVKLYDGAWSE-----------
1okgA           RHNITV--VQADLSSFVFSGSGVTACINIALVHHLGLGHPYLYCGSWSEYSGLFRPPIR-
2eg4A           LSPLERLGLQPGQEVGVYCHSGARSAVAFFVLRSLGV-RARNYLGSMHEW----------
3d1pA           EFEKQIGIPKPDKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGS-NDW----------
1yt8A           ------------------------------------------------------------
1qxnA           EPLLAKSGLDPEKPVVVFCKTAARAALAGKTLREYGFKTIYNSEGGMDKW----------
2kl3A           ------------------------------------------------------------
1qxnA           ------------------------------------------------------------