[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56789.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uc9B.bssp"
#ERROR : Can't open dsspfile "1uc9A.bssp"
#ERROR : Can't open dsspfile "1uc8B.bssp"
#ERROR : Can't open dsspfile "1uc8A.bssp"

## Summary of PDB Search
:307
    8e-10  31%  1uc9B  [c.30.1 - d.142.1] LYSINE BIOSYNTHESIS ENZYME
    8e-10  30%  1uc9A  [c.30.1 - d.142.1] LYSINE BIOSYNTHESIS ENZYME
    1e-09  31%  1uc8B  [c.30.1 - d.142.1] LYSINE BIOSYNTHESIS ENZYME
    1e-09  31%  1uc8A  [c.30.1 - d.142.1] LYSINE BIOSYNTHESIS ENZYME
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1uc9B           ----------------------------------------------------------------------
1uc9A           ----------------------------------------------------------------------
1uc8B           ----------------------------------------------------------------------
1uc8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
1uc9B           ------------LTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRL---MEAFG
1uc9A           ------------LTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRL---MEAFG
1uc8B           ------------LTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRL---MEAFG
1uc8A           ------------LTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRL---MEAFG


                         +         .         .         .         .         *         .:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
1uc9B           YPVVLKPVXXXXXXXXXXXXXXXGFQ-----HQLFYIQEYVE--KPG--RDIRVFVVGERAIAAIYRAEN
1uc9A           YPVVLKPVIXXXXXXXXXXXXXXXXXXFQHQ--LFYIQEYVE--KPG--RDIRVFVVGERAIAAIYRAEN
1uc8B           YPVVLKPVXXXXXXXXXXXXXGFQHQ-------LFYIQEYVE--KPG--RDIRVFVVGERAIAAIYRAEN
1uc8A           YPVVLKPVIXXXXXXXXXXXXXXXXFQHQ----LFYIQEYVE--KPG--RDIRVFVVGERAIAAIYRAEN


                         .         .         .         +         .         .         .:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
1uc9B           --------------CPLTEEVARLSVKXXXXXXXXXXXXDLFES-ERGLLVNEVNHTMEFKNSVHTTGVD
1uc9A           --------------CPLTEEVARLSVKXXXXXXXXXXXXDLFES-ERGLLVNEVNHTMEFKNSVHTTGVD
1uc8B           --------------CPLTEEVARLSVKXXXXXXXXXXXXDLFES-ERGLLVNEVNHTMEFKNSVHTTGVD
1uc8A           --------------CPLTEEVARLSVKXXXXXXXXXXXXDLFES-ERGLLVNEVNHTMEFKNSVHTTGVD


                         .         *         .         .         .         .         +:350
query           IAGALAKxxxxxxxxxxxxxxxxxxxx
1uc9B           IPGEILK--------------------
1uc9A           IPGEILK--------------------
1uc8B           IPGEILK--------------------
1uc8A           IPGEILK--------------------