[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56844.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gqzA.bssp"
#ERROR : Can't open dsspfile "1bwzA.bssp"
#ERROR : Can't open dsspfile "2q9hA.bssp"
#ERROR : Can't open dsspfile "2q9jA.bssp"
#ERROR : Can't open dsspfile "3ejxD.bssp"
#ERROR : Can't open dsspfile "3ejxB.bssp"
#ERROR : Can't open dsspfile "3ejxA.bssp"
#ERROR : Can't open dsspfile "2otnB.bssp"
#ERROR : Can't open dsspfile "2otnA.bssp"
#ERROR : Can't open dsspfile "3fveA.bssp"

## Summary of PDB Search
:276
    2e-70  53%  1gqzA  [d.21.1 - d.21.1] DIAMINOPIMELATE EPIMERASE
    2e-69  53%  1bwzA  [d.21.1 - d.21.1] PROTEIN (DIAMINOPIMELATE EPIMERASE)
    2e-69  53%  2q9hA  [x.x.x] DIAMINOPIMELATE EPIMERASE
    4e-68  53%  2q9jA  [x.x.x] DIAMINOPIMELATE EPIMERASE
    5e-48  44%  3ejxD  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    5e-48  44%  3ejxB  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    5e-48  44%  3ejxA  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    2e-40  36%  2otnB  [x.x.x] DIAMINOPIMELATE EPIMERASE
    2e-40  41%  2otnA  [x.x.x] DIAMINOPIMELATE EPIMERASE
    4e-14  33%  3fveA  [x.x.x] DIAMINOPIMELATE EPIMERASE
:276

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
1gqzA           ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
1bwzA           ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
2q9hA           ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
2q9jA           ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
3ejxD           ----FVKYHGLGNDFILVDNRSEP-KITQEQAAKLCDRNFGVGADGVIFAMPG-VNGTDYAMRIFNSDGS
3ejxB           ----FVKYHGLGNDFILVDNRSEP-KITQEQAAKLCDRNFGVGADGVIFAMPG-VNGTDYAMRIFNSDGS
3ejxA           ----FVKYHGLGNDFILVDNRSEP-KITQEQAAKLCDRNFGVGADGVIFAMPG-VNGTDYAMRIFNSDGS
2otnB           -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
2otnA           -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
3fveA           ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS


                         .         .         *         .         .         .         .:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
1gqzA           EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
1bwzA           EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIRVNMGEPIWEPAKIPFTANKFEKN
2q9hA           EVSQSGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
2q9jA           EVSQ-GNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
3ejxD           EPEMCGNGVRCFARFIAEENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSEAVVE
3ejxB           EPEMCGNGVRCFARFIAEENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSEAVVE
3ejxA           EPEMCGNGVRCFARFIAEENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSEAVVE
2otnB           EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
2otnA           EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
3fveA           AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLG---AGEAVF


                         +         .         .         .         .         *         .:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
1gqzA           YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
1bwzA           YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
2q9hA           YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
2q9jA           YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
3ejxD           AELVVDGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
3ejxB           AELVVDGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
3ejxA           AELVVDGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
2otnB           INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
2otnA           INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
3fveA           HGL----------AVDVGNPHCVDSQLTVDGLAALDVGVSFDG-AQFPDGVNVEVLTAPVDGAVWMRVHE


                         .         .         .         +         .         .         .:280
query           RXXXXXXXXXXXXXXXXVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
1gqzA           RGAGETQXXXXXXXXXXXXXIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
1bwzA           RGAGETQXXXXXXXXXXXXXIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
2q9hA           RGAGETQXXXXXXXXXXXXXIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
2q9jA           RGAGETQXXXXXXXXXXXXXIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
3ejxD           RXXXXXXXXXXXXXXXVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS---
3ejxB           RXXXXXXXXXXXXXXXVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS---
3ejxA           RXXXXXXXXXXXXXXXVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS---
2otnB           RCGTGACAAVVASILNGKMERGK-----EITVHLAGGDLMIAWTEEG-NVLMKGPAEVICRGVYE-
2otnA           RGSXXXXXXXXXXXXXXXXSILNGKMGKEITVHLAGGDLMIAWTEEG-NVLMKGPAEVICRGVYE-
3fveA           R-----------------------------------------------------------------