[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56902.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hv9A.bssp"
#ERROR : Can't open dsspfile "3hvbA.bssp"
#ERROR : Can't open dsspfile "3hv8A.bssp"
#ERROR : Can't open dsspfile "3hvaA.bssp"
#ERROR : Can't open dsspfile "2r6oA.bssp"
#ERROR : Can't open dsspfile "3ii8B.bssp"
#ERROR : Can't open dsspfile "3ii8A.bssp"
#ERROR : Can't open dsspfile "2r6oB.bssp"
#ERROR : Can't open dsspfile "3i5cB.bssp"
#ERROR : Can't open dsspfile "3i5cA.bssp"
#ERROR : Can't open dsspfile "3i5aA.bssp"
#ERROR : Can't open dsspfile "3ignA.bssp"
#ERROR : Can't open dsspfile "3gg0A.bssp"
#ERROR : Can't open dsspfile "3gfzA.bssp"
#ERROR : Can't open dsspfile "3gfxB.bssp"
#ERROR : Can't open dsspfile "3gfxA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "2w27B.bssp"
#ERROR : Can't open dsspfile "3i5bB.bssp"
#ERROR : Can't open dsspfile "3i5bA.bssp"
#ERROR : Can't open dsspfile "1w25A.bssp"
#ERROR : Can't open dsspfile "2v0nA.bssp"
#ERROR : Can't open dsspfile "2w27A.bssp"
#ERROR : Can't open dsspfile "2basB.bssp"
#ERROR : Can't open dsspfile "2basA.bssp"
#ERROR : Can't open dsspfile "3ezuA.bssp"

## Summary of PDB Search
:696
    9e-52  42%  3hv9A  [x.x.x] PROTEIN FIMX
    4e-51  42%  3hvbA  [x.x.x] PROTEIN FIMX
    8e-50  44%  3hv8A  [x.x.x] PROTEIN FIMX
    2e-23  32%  3hvaA  [x.x.x] PROTEIN FIMX
    4e-16  27%  2r6oA  [x.x.x] PUTATIVE DIGUANYLATE CYCLASE/PHOSPHODIESTERASE
    4e-16  27%  3ii8B  [x.x.x] PUTATIVE DIGUANYLATE CYCLASE/PHOSPHODIESTERASE
    4e-16  27%  3ii8A  [x.x.x] PUTATIVE DIGUANYLATE CYCLASE/PHOSPHODIESTERASE
    9e-14  28%  2r6oB  [x.x.x] PUTATIVE DIGUANYLATE CYCLASE/PHOSPHODIESTERASE
    2e-10  30%  3i5cB  [x.x.x] FUSION OF GENERAL CONTROL PROTEIN GCN4 AND WSPR
    2e-10  30%  3i5cA  [x.x.x] FUSION OF GENERAL CONTROL PROTEIN GCN4 AND WSPR
    2e-10  31%  3i5aA  [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN
    3e-10  28%  3ignA  [x.x.x] DIGUANYLATE CYCLASE
    6e-10  21%  3gg0A  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    6e-10  21%  3gfzA  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    6e-10  21%  3gfxB  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    6e-10  21%  3gfxA  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    3e-09  28%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    3e-09  28%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    5e-09  25%  2w27B  [x.x.x] YKUI PROTEIN
    9e-09  29%  3i5bB  [x.x.x] WSPR RESPONSE REGULATOR
    9e-09  29%  3i5bA  [x.x.x] WSPR RESPONSE REGULATOR
    2e-08  26%  1w25A  [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
    2e-08  26%  2v0nA  [x.x.x] RESPONSE REGULATOR PLED
    3e-08  25%  2w27A  [x.x.x] YKUI PROTEIN
    3e-08  23%  2basB  [x.x.x] YKUI PROTEIN
    3e-08  23%  2basA  [x.x.x] YKUI PROTEIN
    2e-05  26%  3ezuA  [x.x.x] GGDEF DOMAIN PROTEIN
:696

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           ----------------------------------------------------------------------
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2w27B           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           ----------------------------------------------------------------------
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2w27B           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           ----------------------------------------------------------------------
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2w27B           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKTYDLAAEERIKQVQQRDILTGFFS
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           ----------------------------------------------------------VSSQDPVTGLYN
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           ---------------------------------------------KNYHLENEARLKKLVNSDGLTGLSN
3i5cA           ---------------------------------------------KNYHLENEARLKKLVNSDGLTGLSN
3i5aA           -------------------------------------------------------LQRLMNSDGLTGLSN
3ignA           --------------------------------------------------------------DRLTGLLN
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           -------------------------------------------------------LQRLMNSDGLTGLSN
3breA           -------------------------------------------------------LQRLMNSDGLTGLSN
2w27B           ----------------------------------------------------------------------
3i5bB           --------------------------------------------------------------DGLTGLSN
3i5bA           --------------------------------------------------------------DGLTGLSN
1w25A           --------------------------------------------------------------DQLTGLHN
2v0nA           --------------------------------------------------------------DQLTGLHN
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           --------------------------------------------------------------DALTGV-T


                         .         *         .         .         .         .         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           RSHFLDLMDAAVQQAVTARKPSTLAYIHLNGYPSLQADHGLSGIDLLLGQLAGLMREQFGEEADLARFGD
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
3i5cA           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
3i5aA           RRHFDEYLEEWRRATR-DQAQLSLLMIDVDYFKAYNDNFGHLEGDEALRQVAKAIRNSCSRPSDLARYGG
3ignA           RGTWENLVDAEYERFRRYGQATSLVF-DIDHFKPVNDTYGHLAGDEVIRHTADVTRNNIRQSDSAGRYGG
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
3breA           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
2w27B           ----------------------------------------------------------------------
3i5bB           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
3i5bA           RRHFDEYLEMEWXXXXXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLARYGG
1w25A           RRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGG
2v0nA           RRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGG
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           RAGFFKTVGSLAYAAQRSGSNVGIL-IDLDYFKLVGQ-----TGDRILQLVAETITSHLRRSDVVGRYDG


                         .         .         .         .         *         .         .:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
3hv9A           ----------------------------------------------------------------------
3hvbA           ----------------------------------------------------------------------
3hv8A           ----------------------------------------------------------------------
3hvaA           SIFAALFKGKTPEQAQAALQRLLKKVENHLFELNGRSAQATLSIGVAGLDEKTAKAQDVMNRAHRCADDA
2r6oA           ----------------------------------------------------------------------
3ii8B           ----------------------------------------------------------------------
3ii8A           ----------------------------------------------------------------------
2r6oB           ----------------------------------------------------------------------
3i5cB           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
3i5cA           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
3i5aA           EEFAMVLPNTSPGGARLLAEKLRQSVAPHIAPVPGSSL--TVSIGVATVPQVGQHSRQLILDADKGLYLA
3ignA           EEFGIILPETDAESARVICERIREAIEKSTVSTSAGDIQYTVS-GIAQLTETPENYQ--WQKADEALYKA
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
3breA           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
2w27B           ----------------------------------------------------------------------
3i5bB           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
3i5bA           EEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPGSHLTVSIGVSTL---VPGGRVLIEMADQALYQA
1w25A           EEFVVIMPDTALADALRIAERIRMHVSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQA
2v0nA           EEFVVIMPDTALADALRIAERIRMHVSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQA
2w27A           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3ezuA           DEFVVYLSPVEPASLRTVAENLRRSI-----EEESARVPVTASIGVAQLGTDVDGGIEELVRLADECLQA


                         .         .         +         .         .         .         .:490
query           QEAGGNRIERxxxxxxxxxxxxxxxxxEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
3hv9A           ------------------------------LQQALET-NSFRLLFQPVISLRGDSHENYEVLLRLLNPQG
3hvbA           ------------------------------LQQALET-NSFRLLFQPVISLRGDSHENYEVLLRLLNPQG
3hv8A           ------------------------------LQQALET-NSFRLLFQPVISLRGDSHENYEVLLRLLNPQG
3hvaA           ARKGGSQIKQ------------------------------------------------------------
2r6oA           ---------------------------DTRLRQALERNE-LVLHYQPIVELASGRIVGGEALVRWEDPER
3ii8B           ---------------------------DTRLRQALERNE-LVLHYQPIVELASGRIVGGEALVRWEDPER
3ii8A           ---------------------------DTRLRQALERNE-LVLHYQPIVELASGRIVGGEALVRWEDPER
2r6oB           ---------------------------DTRLRQALERNE-LVLHYQPIVELASGRIVGGEALVRWEDDTG
3i5cB           KNNGRNQV--------------------------------------------------------------
3i5cA           KNNGRNQV--------------------------------------------------------------
3i5aA           KNNGRNQV--------------------------------------------------------------
3ignA           KESGRNKV--------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3breB           KNNGRNQV--------------------------------------------------------------
3breA           KNNGRNQV--------------------------------------------------------------
2w27B           --------------------------------DILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
3i5bB           KNNGRNQV--------------------------------------------------------------
3i5bA           KNNGRNQV--------------------------------------------------------------
1w25A           KASGRNAV--------------------------------------------------------------
2v0nA           KASGRNAV--------------------------------------------------------------
2w27A           --------------------------------DILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
2basB           --------------------------------DILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
2basA           --------------------------------DILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
3ezuA           KYTGKNKV--------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
3hv9A           QEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAA
3hvbA           QEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAA
3hv8A           QEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLL-AEHQT----KLFVHLSSASLQDPGLLPWLGVALKAA
3hvaA           ----------------------------------------------------------------------
2r6oA           G-LVPSAFIPAAEDTGLIVALSDWVLEACCTQLRAWQQQGRALTLSVNISTRQFEGEHLTRAVDRALARS
3ii8B           G-LVPSAFIPAAEDTGLIVALSDWVLEACCTQLRAWQQQGRALTLSVNISTRQFEGEHLTRAVDRALARS
3ii8A           G-LVPSAFIPAAEDTGLIVALSDWVLEACCTQLRAWQQQGRALTLSVNISTRQFEGEHLTRAVDRALARS
2r6oB           ----------------LIVALSDWVLEACCTQLRAWQQQGRALTLSVNISTRQFEGEHLTRAVDRALARS
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
3gg0A           ------------------------------------------------------HHPDAVGWLMDSLLAA
3gfzA           ------------------------------------------------------HHPDAVGWLMDSLLAA
3gfxB           ------------------------------------------------------HHPDAVGWLMDSLLAA
3gfxA           ------------------------------------------------------HHPDAVGWLMDSLLAA
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2w27B           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALD------------RFLEADSDLLIQDANLLMLLLKEYEAK
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2w27A           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALD------------RFLEADSDLLIQDANLLMLLLKEYEAK
2basB           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALD--RFLEADSDLLIFNQDANLLLDHGESFLELLKEY-EAK
2basA           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALD--RFLEADSDLLIFNQDANLLLDHGESFLELLKEY-EAK
3ezuA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
3hv9A           RLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDL
3hvbA           RLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDL
3hv8A           RLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDL
3hvaA           ----------------------------------------------------------------------
2r6oA           GLRPDCLELEITENVLVT--DEVRTCLDALRARGVRLALDDFGTGYSSLSYLSQLPFHGLKIDQSFVRKI
3ii8B           GLRPDCLELEITENVLVT--DEVRTCLDALRARGVRLALDDFGTGYSSLSYLSQLPFHGLKIDQSFVRKI
3ii8A           GLRPDCLELEITENVLVT--DEVRTCLDALRARGVRLALDDFGTGYSSLSYLSQLPFHGLKIDQSFVRKI
2r6oB           GLRPDCLELEITENVLVT--DEVRTCLDALRARGVRLALDDFGTGYSSLSYLSQLPFHGLKIDQSFVRKI
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
3gg0A           GLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPDKIKVDAELVRDI
3gfzA           GLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPDKIKVDAELVRDI
3gfxB           GLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPDKIKVDAELVRDI
3gfxA           GLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPDKIKVDAELVRDI
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2w27B           GIELHRFVLEITEHNFEGDIEQLYHMLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKID----LQA
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2w27A           GIELHRFVLEITEHNFEGDIEQLYHMLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQAL---
2basB           GIELHRFVLEITEHNFEGDIEQLYHLAY-YRTYGIKIAVDNIGKESSNLDRIALLSPDLLKID----LQA
2basA           GIELHRFVLEITEHNFEGDIEQLYHLAY-YRTYGIKIAVDNIGKESSNLDRIALLSPDLLKID----LQA
3ezuA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPNQFLSYEFSGGx
3hv9A           NQVE-NQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFSSG-
3hvbA           NQVE-NQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS---
3hv8A           NQVE-NQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS---
3hvaA           ------------------------------------------------------------------
2r6oA           PAHPSETQIVTTILALARGLGE-VVAEGIETAQQYAFLRDRGCEFGQG------------------
3ii8B           PAHPSETQIVTTILALARGLGE-VVAEGIETAQQYAFLRDRGCEFGQG------------------
3ii8A           PAHPSETQIVTTILALARGLGE-VVAEGIETAQQYAFLRDRGCEFGQG------------------
2r6oB           PAHPSETQIVTTILALARGLGE-VVAEGIETAQQYAFLRDRGCEFGQG------------------
3i5cB           ------------------------------------------------------------------
3i5cA           ------------------------------------------------------------------
3i5aA           ------------------------------------------------------------------
3ignA           ------------------------------------------------------------------
3gg0A           HISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRP------------
3gfzA           HISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRP------------
3gfxB           HISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRP------------
3gfxA           HISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRP------------
3breB           ------------------------------------------------------------------
3breA           ------------------------------------------------------------------
2w27B           LKSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSE----------
3i5bB           ------------------------------------------------------------------
3i5bA           ------------------------------------------------------------------
1w25A           ------------------------------------------------------------------
2v0nA           ------------------------------------------------------------------
2w27A           --SPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSE----------
2basB           LKSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSE----------
2basA           LKSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSE----------
3ezuA           ------------------------------------------------------------------