[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56915.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vfgB.bssp"
#ERROR : Can't open dsspfile "1vfgA.bssp"
#ERROR : Can't open dsspfile "3h38A.bssp"
#ERROR : Can't open dsspfile "1miyA.bssp"
#ERROR : Can't open dsspfile "3h3aB.bssp"
#ERROR : Can't open dsspfile "3h3aA.bssp"
#ERROR : Can't open dsspfile "3h39B.bssp"
#ERROR : Can't open dsspfile "3h39A.bssp"
#ERROR : Can't open dsspfile "3h37B.bssp"
#ERROR : Can't open dsspfile "3h37A.bssp"
#ERROR : Can't open dsspfile "1ou5A.bssp"
#ERROR : Can't open dsspfile "1mivA.bssp"

## Summary of PDB Search
:406
    6e-18  40%  1vfgB  [d.218.1 - a.173.1] POLY A POLYMERASE
    6e-18  40%  1vfgA  [d.218.1 - a.173.1] POLY A POLYMERASE
    7e-17  35%  3h38A  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    6e-16  33%  1miyA  [d.218.1 - a.173.1] TRNA CCA-ADDING ENZYME
    6e-16  36%  3h3aB  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    6e-16  32%  3h3aA  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    2e-15  34%  3h39B  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    4e-15  31%  3h39A  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    7e-14  37%  3h37B  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    9e-14  35%  3h37A  [x.x.x] TRNA NUCLEOTIDYL TRANSFERASE-RELATED PROTEIN
    7e-09  30%  1ou5A  [d.218.1 - a.173.1] TRNA CCA-ADDING ENZYME
    2e-08  38%  1mivA  [d.218.1 - a.173.1] TRNA CCA-ADDING ENZYME
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPG
1vfgB           LRAYIVGGVVRDILLGKEVWDVDFVVEGNALAKELARRHGVNVHPFPEFAHGKLKLEFATARRE------
1vfgA           LRAYIVGGVVRDILLGKEVWDVDFVVEGNALAKELARRHGVNVHPFPEFAHGKLKLEFATARRE------
3h38A           MPVYVVGGFVRDLLLGIKNLDIDIVVEGNAPGKLVKHDKFMTAS---LFLKGGLRIDIATARLEYYESPA
1miyA           -DAYFVGGAVRDLLLGRPIGDVD-IATSALPEDVMAIFPKTIDXXXXXXXXXXXXXXXAYEVTTFKTDGS
3h3aB           MPVYVVGGFVRDLLLGIKNLDIDIVVEGNAPGKLVKHDKFMTAS---LFLKGGLRIDIATARLE------
3h3aA           MPVYVVGGFVRDLLLGIKNLDIDIVVEGN------ALEFAEYAKRFL----PGKLVKHDKFMTASLFLKG
3h39B           MPVYVVGGFVRDLLLGIKNLDIDIVVEGNAPGKLVKHDKFMTAS---LFLKGGLRIDIATARLEMS----
3h39A           MPVYVVGGFVRDLLLGIKNLDIDIVVEGN------ALEFAEYAKRFKLVKHDKFMTASLFLKGGLRIDIA
3h37B           --VYVVGGFVRDLLLGIKNLDIDIVVEGN------ALEFAEYAKRFL---------PGKLVKHDKFTASL
3h37A           --VYVVGGFVRDLLLGIKNLDIDIVVEGN------ALEFAEYAKRFL---------PGKLVKHDKFTASL
1ou5A           -ELRIAGGAVRDLLNG--VKPQDIDFATTATPTQMKEMFQSAG----IRMINNRGEKHGTITARLHE---
1mivA           -DAYFVGGAVRDLLLGRPIGDVD-IATSALP------------EDVAIFPKTIDXXXXXXXXXXXXXXXA


                         .         .         *         .         .         .         .:140
query           YKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGILRHVSPAFAEDPVRILXXXX
1vfgB           -------TVEPASLKEDLIRRDFTINAMAISVNGTLIDYFGGLRDLKDKVIRVLHPSFIEDPVRILRALR
1vfgA           -------TVEPASLKEDLIRRDFTINAMAISVNGTLIDYFGGLRDLKDKVIRVLHPSFIEDPVRILRALR
3h38A           -------KLPDVTIKKDLYRRDFTINAMAIKLNGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
1miyA           VTFVR-------SLEEDLKRRDFTMNAIAMDEYGTIIDPFGGREAXXXXXXXTVGEAFREDALRMMRAVR
3h3aB           ---------PDVTIKKDLYRRDFTINAMAIKLNGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
3h3aA           GLRIDIATAEMSTIKKDLYRRDFTINAMAIKLNGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
3h39B           ------------TIKKDLYRRDFTINAMAIKLNGLLIDFFGGYRDLKEGVIRVLTLSFVDDPTRILRAIR
3h39A           TARLDVEMS---TIKKDLYRRDFTINAMAIKLNGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
3h37B           FLGLRIDIAPDVTIKKDLYRRDFTINAAIKLNPGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
3h37A           FLGLRIDATAESTIKKDLYRRDFTINAAIKLNPGLLIDFFGGYRDLKEGVIRVLHTSFVDDPTRILRAIR
1ou5A           -ENFEITTLRIFTTDKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRHAKQRIQEDYLRILRYFR
1mivA           YETFKTDGSVTFSLEEDLKRRDFT-NAIADEY-GTIIDPFGGREAXXXXXXXTVGEAFREDALR------


                         +         .         .         .         .         *         .:210
query           XXXXXXXKVAPETLALMEAMVTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPExxxx
1vfgB           FAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALRED---RFLEIL----------------
1vfgA           FAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALRED---RFLEIL----------------
3h38A           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNPLKSIRRMAQFDVIKHLFPK----
1miyA           FVSELGFALAPDT---EQAIVNAPLLAHISVERMTMEMEKLLGGPFAARALPLLAETG------------
3h3aB           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNPLKSIRRMAQFDVIKHLFPK----
3h3aA           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNPLKSIRRMAQFDVIKHLFPK----
3h39B           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNPLKSIRRMAQFDVIKHLFPK----
3h39A           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNPLKSIRRMAQFDVIKHLFPK----
3h37B           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNP-----------------------
3h37A           FEQRFDFRIEETTERLLKQAVEEGYLERTTGPRLRQELEKILEEKNP-----------------------
1ou5A           FYGRIVDKPGDHDPETLEAIANAKGLAGISGERIWVELKKIL----------------------------
1mivA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vfgB           ----------------------------------------------------------------------
1vfgA           ----------------------------------------------------------------------
3h38A           ----------------------------------------------------------------------
1miyA           ----------------------------------------------------------------------
3h3aB           ----------------------------------------------------------------------
3h3aA           ----------------------------------------------------------------------
3h39B           ----------------------------------------------------------------------
3h39A           ----------------------------------------------------------------------
3h37B           ----------------------------------------------------------------------
3h37A           ----------------------------------------------------------------------
1ou5A           ----------------------------------------------------------------------
1mivA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vfgB           ----------------------------------------------------------------------
1vfgA           ----------------------------------------------------------------------
3h38A           ----------------------------------------------------------------------
1miyA           ----------------------------------------------------------------------
3h3aB           ----------------------------------------------------------------------
3h3aA           ----------------------------------------------------------------------
3h39B           ----------------------------------------------------------------------
3h39A           ----------------------------------------------------------------------
3h37B           ----------------------------------------------------------------------
3h37A           ----------------------------------------------------------------------
1ou5A           ----------------------------------------------------------------------
1mivA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vfgB           --------------------------------------------------------
1vfgA           --------------------------------------------------------
3h38A           --------------------------------------------------------
1miyA           --------------------------------------------------------
3h3aB           --------------------------------------------------------
3h3aA           --------------------------------------------------------
3h39B           --------------------------------------------------------
3h39A           --------------------------------------------------------
3h37B           --------------------------------------------------------
3h37A           --------------------------------------------------------
1ou5A           --------------------------------------------------------
1mivA           --------------------------------------------------------