[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA56917.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3etfD.bssp"
#ERROR : Can't open dsspfile "3etfC.bssp"
#ERROR : Can't open dsspfile "3etfB.bssp"
#ERROR : Can't open dsspfile "3efvC.bssp"
#ERROR : Can't open dsspfile "3efvA.bssp"
#ERROR : Can't open dsspfile "2ve5A.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "2ve5C.bssp"
#ERROR : Can't open dsspfile "2w8nA.bssp"
#ERROR : Can't open dsspfile "3ifgA.bssp"
#ERROR : Can't open dsspfile "2opxA.bssp"
#ERROR : Can't open dsspfile "2hg2A.bssp"
#ERROR : Can't open dsspfile "2w8pA.bssp"
#ERROR : Can't open dsspfile "2iluA.bssp"
#ERROR : Can't open dsspfile "2w8oA.bssp"
#ERROR : Can't open dsspfile "1o02A.bssp"
#ERROR : Can't open dsspfile "1o01C.bssp"
#ERROR : Can't open dsspfile "2onnA.bssp"
#ERROR : Can't open dsspfile "1o04A.bssp"
#ERROR : Can't open dsspfile "1bxsA.bssp"
#ERROR : Can't open dsspfile "2onmA.bssp"
#ERROR : Can't open dsspfile "1o9jA.bssp"
#ERROR : Can't open dsspfile "3b4wA.bssp"
#ERROR : Can't open dsspfile "3fg0E.bssp"
#ERROR : Can't open dsspfile "3fg0D.bssp"
#ERROR : Can't open dsspfile "3fg0C.bssp"
#ERROR : Can't open dsspfile "3fg0A.bssp"
#ERROR : Can't open dsspfile "3ed6A.bssp"
#ERROR : Can't open dsspfile "1a4zA.bssp"
#ERROR : Can't open dsspfile "2o2pA.bssp"
#ERROR : Can't open dsspfile "1bi9C.bssp"
#ERROR : Can't open dsspfile "1bi9B.bssp"
#ERROR : Can't open dsspfile "1bi9A.bssp"
#ERROR : Can't open dsspfile "1bi9D.bssp"
#ERROR : Can't open dsspfile "3ek1G.bssp"
#ERROR : Can't open dsspfile "3ek1B.bssp"
#ERROR : Can't open dsspfile "3ek1A.bssp"
#ERROR : Can't open dsspfile "1wnbA.bssp"
#ERROR : Can't open dsspfile "1euhA.bssp"
#ERROR : Can't open dsspfile "2id2C.bssp"
#ERROR : Can't open dsspfile "2id2A.bssp"
#ERROR : Can't open dsspfile "2esdA.bssp"
#ERROR : Can't open dsspfile "1qi1A.bssp"
#ERROR : Can't open dsspfile "1zumC.bssp"
#ERROR : Can't open dsspfile "1t90A.bssp"
#ERROR : Can't open dsspfile "1zumA.bssp"
#ERROR : Can't open dsspfile "1zumE.bssp"
#ERROR : Can't open dsspfile "1zumJ.bssp"
#ERROR : Can't open dsspfile "1zumI.bssp"
#ERROR : Can't open dsspfile "1zumD.bssp"
#ERROR : Can't open dsspfile "1zumB.bssp"
#ERROR : Can't open dsspfile "3i44A.bssp"
#ERROR : Can't open dsspfile "2d4eC.bssp"
#ERROR : Can't open dsspfile "2d4eA.bssp"
#ERROR : Can't open dsspfile "1zumL.bssp"
#ERROR : Can't open dsspfile "1zumK.bssp"
#ERROR : Can't open dsspfile "3ju8A.bssp"
#ERROR : Can't open dsspfile "2bhpA.bssp"
#ERROR : Can't open dsspfile "2j6lB.bssp"
#ERROR : Can't open dsspfile "2j6lA.bssp"
#ERROR : Can't open dsspfile "1uzbA.bssp"
#ERROR : Can't open dsspfile "2jg7A.bssp"
#ERROR : Can't open dsspfile "2bjaA.bssp"
#ERROR : Can't open dsspfile "1ky8A.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1uxvA.bssp"
#ERROR : Can't open dsspfile "1uxnA.bssp"
#ERROR : Can't open dsspfile "2vroB.bssp"
#ERROR : Can't open dsspfile "2vroA.bssp"
#ERROR : Can't open dsspfile "1eyyB.bssp"
#ERROR : Can't open dsspfile "1eyyA.bssp"
#ERROR : Can't open dsspfile "1co3B.bssp"
#ERROR : Can't open dsspfile "1co3A.bssp"
#ERROR : Can't open dsspfile "1o20A.bssp"

## Summary of PDB Search
:454
    5e-87  48%  3etfD  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    5e-87  48%  3etfC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    5e-87  48%  3etfB  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    5e-87  48%  3efvC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    5e-87  48%  3efvA  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    3e-62  31%  2ve5A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    5e-61  32%  1a4sA  [c.82.1] BETAINE ALDEHYDE DEHYDROGENASE
    7e-61  32%  2ve5C  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    6e-59  37%  2w8nA  [x.x.x] SUCCINATE-SEMIALDEHYDE DEHYDROGENASE,
    6e-59  32%  3ifgA  [x.x.x] SUCCINATE-SEMIALDEHYDE DEHYDROGENASE (NADP+)
    4e-58  32%  2opxA  [x.x.x] ALDEHYDE DEHYDROGENASE A
    4e-58  32%  2hg2A  [x.x.x] ALDEHYDE DEHYDROGENASE A
    7e-58  37%  2w8pA  [x.x.x] SUCCINIC SEMIALDEHYDE DEHYDROGENASE
    3e-57  32%  2iluA  [x.x.x] ALDEHYDE DEHYDROGENASE A
    2e-56  37%  2w8oA  [x.x.x] SUCCINIC SEMIALDEHYDE DEHYDROGENASE
    2e-55  32%  1o02A  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-55  32%  1o01C  [c.82.1] ALDEHYDE DEHYDROGENASE
    7e-55  32%  2onnA  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-54  32%  1o04A  [c.82.1] ALDEHYDE DEHYDROGENASE, MITOCHONDRIAL PRECURSOR
    8e-54  33%  1bxsA  [c.82.1] ALDEHYDE DEHYDROGENASE
    5e-53  32%  2onmA  [x.x.x] ALDEHYDE DEHYDROGENASE, MITOCHONDRIAL PRECURSOR
    1e-52  31%  1o9jA  [c.82.1] ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1
    2e-52  33%  3b4wA  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-52  30%  3fg0E  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    4e-52  30%  3fg0D  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    4e-52  30%  3fg0C  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    4e-52  30%  3fg0A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    4e-52  30%  3ed6A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    9e-52  31%  1a4zA  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-49  30%  2o2pA  [x.x.x] FORMYLTETRAHYDROFOLATE DEHYDROGENASE
    5e-48  31%  1bi9C  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    8e-48  32%  1bi9B  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    8e-48  32%  1bi9A  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    1e-47  31%  1bi9D  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    2e-45  29%  3ek1G  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-45  29%  3ek1B  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-45  29%  3ek1A  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-44  29%  1wnbA  [c.82.1] PUTATIVE BETAINE ALDEHYDE DEHYDROGENASE
    7e-44  31%  1euhA  [c.82.1] NADP DEPENDENT NON PHOSPHORYLATING
    2e-43  31%  2id2C  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
    2e-43  31%  2id2A  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
    4e-43  31%  2esdA  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
    1e-42  31%  1qi1A  [c.82.1] PROTEIN (NADP-DEPENDENT NONPHOSPHORYLATING
    2e-42  31%  1zumC  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-42  29%  1t90A  [x.x.x] PROBABLE METHYLMALONATE-SEMIALDEHYDE
    2e-42  31%  1zumA  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-42  31%  1zumE  [x.x.x] ALDEHYDE DEHYDROGENASE
    5e-42  31%  1zumJ  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-41  31%  1zumI  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-41  31%  1zumD  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-41  31%  1zumB  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-40  29%  3i44A  [x.x.x] ALDEHYDE DEHYDROGENASE
    8e-40  27%  2d4eC  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    8e-40  27%  2d4eA  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    4e-39  31%  1zumL  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-36  31%  1zumK  [x.x.x] ALDEHYDE DEHYDROGENASE
    8e-35  28%  3ju8A  [x.x.x] SUCCINYLGLUTAMIC SEMIALDEHYDE DEHYDROGENASE
    2e-34  32%  2bhpA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    5e-34  27%  2j6lB  [x.x.x] ALDEHYDE DEHYDROGENASE FAMILY 7 MEMBER A1
    5e-34  27%  2j6lA  [x.x.x] ALDEHYDE DEHYDROGENASE FAMILY 7 MEMBER A1
    7e-34  31%  1uzbA  [c.82.1] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    9e-34  27%  2jg7A  [x.x.x] ANTIQUITIN
    4e-32  31%  2bjaA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    1e-31  26%  1ky8A  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    1e-31  27%  1ad3A  [c.82.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    2e-31  26%  1uxvA  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE (NADP+)
    3e-31  26%  1uxnA  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE (NADP+)
    2e-14  24%  2vroB  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-14  24%  2vroA  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-08  28%  1eyyB  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-08  28%  1eyyA  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-08  28%  1co3B  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-08  28%  1co3A  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-04  26%  1o20A  [c.82.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
3etfD           ----SVNPATGQTLAA--PWNAQEIEHALSLAASGFKKWKT-SVAQRAQTLRDIGQALRAHAEE-AQCIT
3etfC           ----SVNPATGQTLAA--PWNAQEIEHALSLAASGFKKWKT-SVAQRAQTLRDIGQALRAHAEE-AQCIT
3etfB           ----SVNPATGQTLAA--PWNAQEIEHALSLAASGFKKWKT-SVAQRAQTLRDIGQALRAHAEE-AQCIT
3efvC           ----SVNPATGQTLAA--PWNAQEIEHALSLAASGFKKWKT-SVAQRAQTLRDIGQALRAHAEE-AQCIT
3efvA           ----SVNPATGQTLAA--PWNAQEIEHALSLAASGFKKWKT-SVAQRAQTLRDIGQALRAHAEE-AQCIT
2ve5A           --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALET
1a4sA           -------PATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEV
2ve5C           --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALET
2w8nA           --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
3ifgA           --FEVFDPATGESLGTVPKMXXXXXXXXXXXXXXXXXXXXMKTAKERAAILRRWFDLVIANSDDLALILT
2opxA           -----VNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERATEISALIV
2hg2A           -----VNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIV
2w8pA           --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
2iluA           -----VNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIV
2w8oA           --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
1o02A           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1o01C           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
2onnA           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1o04A           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1bxsA           -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLIERDRLLLATMEA
2onmA           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1o9jA           --------------------------------QMGSP-WRTMDASERGQLIYKLADLIERDRLLLATLES
3b4wA           --------------------------------------WPSTPPHERXXXXXXXXKMLAERKDLFTKLLA
3fg0E           --------------------------------------WSQETAETRGKKVRAIADKIKEHREALARLET
3fg0D           --------------------------------------WSQETAETRGKKVRAIADKIKEHREALARLET
3fg0C           --------------------------------------WSQETAETRGKKVRAIADKIKEHREALARLET
3fg0A           --------------------------------------WSQETAETRGKKVRAIADKIKEHREALARLET
3ed6A           --------------------------------------WSQETAETRGKKVRAIADKIKEHREALARLET
1a4zA           --FPTVNPSTGDVICHVAEGDXXXXXXXXXXXQLGSP-WRRMDASERGRLLNRLADLIERDRTYLAALET
2o2pA           -------------------------------------LWGKINARDRGRLLYRLADVMEQHQEELATIEA
1bi9C           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
1bi9B           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
1bi9A           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
1bi9D           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
3ek1G           ------NPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFXXXXXXXXXXXXXMT
3ek1B           ------NPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFXXXXXXXXXXXXXMT
3ek1A           ------NPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFXXXXXXXXXXXXXMT
1wnbA           ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
1euhA           -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
2id2C           -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
2id2A           -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
2esdA           -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
1qi1A           -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
1zumC           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1t90A           -----VNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLIT
1zumA           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumE           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumJ           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumI           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumD           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumB           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
3i44A           --------------------------------------WKTTSPHERLGFVEKILEIYEKRSSDMAKTIS
2d4eC           --FPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMEC
2d4eA           --FPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMEC
1zumL           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
1zumK           --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
3ju8A           ---ESLDPVGQGVVWSGRGADATQVDAAVCAAREAFPAWARRPLEQRIELLERFAATLKSRADELARVIG
2bhpA           ----------------------------------------------------------------------
2j6lB           ----------------------------VKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVS
2j6lA           ----------------------------VKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVS
1uzbA           ----------------------------------------------------------------------
2jg7A           ----------------------------VQKTREAWKMWADIPAPKRGEIVRQIGDALRKKIKVLGSLVS
2bjaA           ----------------------------------------------------------------------
1ky8A           --------------------------------------WSARDMTERLAVLRKAADIIERNLDVFAEVLV
1ad3A           -----------------------SISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALA
1uxvA           --------------------------------------WSARDMTERLAVLRKAADIIERNLDVFAEVLV
1uxnA           --------------------------------------WSARDMTERLAVLRKAADIIERNLDVFAEVLV
2vroB           --------------------------------------------AQRAARLADIVKLLQAKRGDYYAIAT
2vroA           --------------------------------------------AQRAARLADIVKLLQAKRGDYYAIAT
1eyyB           --------------------------------------------SKRASLLRTIASELEARSDDIIARAH
1eyyA           --------------------------------------------SKRASLLRTIASELEARSDDIIARAH
1co3B           --------------------------------------------SKRASLLRTIASELEARSDDIIARAH
1co3A           --------------------------------------------SKRASLLRTIASELEARSDDIIARAH
1o20A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
3etfD           RE-GKPIKQARAEVTKSAALCDWYAEHGPALNPEPTLVEN-QQAVIEYRPLGVILAI-PWNFPLWQVLRG
3etfC           RE-GKPIKQARAEVTKSAALCDWYAEHGPALNPEPTLVEN-QQAVIEYRPLGVILAI-PWNFPLWQVLRG
3etfB           RE-GKPIKQARAEVTKSAALCDWYAEHGPALNPEPTLVEN-QQAVIEYRPLGVILAI-PWNFPLWQVLRG
3efvC           RE-GKPIKQARAEVTKSAALCDWYAEHGPALNPEPTLVEN-QQAVIEYRPLGVILAI-PWNFPLWQVLRG
3efvA           RE-GKPIKQARAEVTKSAALCDWYAEHGPALNPEPTLVEN-QQAVIEYRPLGVILAI-PWNFPLWQVLRG
2ve5A           LDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
1a4sA           INNGKTITEAEYDID-AAWQCEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWK
2ve5C           LDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
2w8nA           AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGD-IIHTPARRALVLKQPIGVAAVITPWNFPSAMITRK
3ifgA           TEQGKPLAEAKGEIAYAASFIEWFAEEGKRVAGDTLPTPDAKRIVVVKEPIGVCAAITPWNFPAAMIARK
2opxA           EEGGKIQQLAEVEVAFTADYIDYMAEWARRY-EGEIIQSDRPGENILLRALGVTTGILPWNFPFFLIARK
2hg2A           EEGGKIQQLAEVEVAFTADYIDYMAEWARRY-EGEIIQSDRPGENILLRALGVTTGILPWNFPFFLIARK
2w8pA           AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGD-IIHTPARRALVLKQPIGVAAVITPWNFPSAMITRK
2iluA           EEGGKIQQLAEVEVAFTADYIDYMAEWARRY-EGEIIQSDRPGENILLRALGVTTGILPWNFPFFLIARK
2w8oA           AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGD-IIHTPARRALVLKQPIGVAAVITPWNFPSAMITRK
1o02A           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1o01C           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
2onnA           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1o04A           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1bxsA           MNGGKLFSNAYLDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWK
2onmA           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1o9jA           INAGKVFASAYLDLDYCIKALRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGLIFPWNAPMILLACK
3b4wA           AETG----QPPTIIETMHWMMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLAVNK
3fg0E           LDTGKTLEESYADMDDIHNVFMYFAGLADKD-GGEMIDSPITESKIVKEPVGVVTQITPWNYPLLQASWK
3fg0D           LDTGKTLEESYADMDDIHNVFMYFAGLADKD-GGEMIDSPITESKIVKEPVGVVTQITPWNYPLLQASWK
3fg0C           LDTGKTLEESYADMDDIHNVFMYFAGLADKD-GGEMIDSPITESKIVKEPVGVVTQITPWNYPLLQASWK
3fg0A           LDTGKTLEESYADMDDIHNVFMYFAGLADKD-GGEMIDSPITESKIVKEPVGVVTQITPWNYPLLQASWK
3ed6A           LDTGKTLEESYADMDDIHNVFMYFAGLADKD-GGEMIDSPITESKIVKEPVGVVTQITPWNYPLLQASWK
1a4zA           LDNGKYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWK
2o2pA           LDAGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGATIPINQARPNLTKKEPVGVCGIVIPWNYPLMMLSWK
1bi9C           LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1bi9B           LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1bi9A           LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1bi9D           LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
3ek1G           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIAPQNGQRLTVIRQPVGVTAAITPWNFPAAMITRK
3ek1B           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIAPQNGQRLTVIRQPVGVTAAITPWNFPAAMITRK
3ek1A           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIAPQNGQRLTVIRQPVGVTAAITPWNFPAAMITRK
1wnbA           RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
1euhA           KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
2id2C           KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
2id2A           KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
2esdA           KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
1qi1A           KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
1zumC           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1t90A           IENGKNTKEALGEVGRGIENVEF-AAGAPSLMMGDSLASIATDVEAARYPIGVVGGIAPFNFPMMVPCWM
1zumA           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumE           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumJ           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumI           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumD           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumB           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
3i44A           MEMGAPIDMANAQTATGSSHIRNFIKAYKEFSFQEALIEGNEQAILHYDAIGVVGLITPWNWPMNQVTLK
2d4eC           LDAGQVLRIVRAQVXXXXXXXXXXXXXXXXXXXDRTFPVDRDWLYYTVRPAGPVGIITPWNAPLMLSTWR
2d4eA           LDAGQVLRIVRAQVXXXXXXXXXXXXXXXXXXXDRTFPVDRDWLYYTVRPAGPVGIITPWNAPLMLSTWR
1zumL           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1zumK           LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
3ju8A           EETGKPLWESATEVTSVNKVAISVQAFRERTGEKSGPLADA-TAVLRHKPHGVVAVFGPYNFPGHLPNGH
2bhpA           -------------------------------------------------PLGAGVVIAPWNFPVAIFTGM
2j6lB           LEMGKILVEGVGEVQEYVDICDY-AVGLSRMIGGPILPSE--RSGHALNPVGLVGIITAFNFPVAVYGWN
2j6lA           LEMGKILVEGVGEVQEYVDICDY-AVGLSRMIGGPILPSE--RSGHALNPVGLVGIITAFNFPVAVYGWN
1uzbA           -------------------------------------------------PLGAGVVIAPWNFPVAIFTGM
2jg7A           LEMGKIXXXXXXXXXXXXXXCDY-AVGLSRMIGGPVLPSE-RPGHALIEPVGLVGIITAFNFPVAVYGWN
2bjaA           -------------------------------------------------PLGAGVVIAPWNFPVAIFTGM
1ky8A           MNAGKAVGEVKAAVDRLRLAELDLKKIGGDYIGDWTYDTLETEGLVRREPLGVVAAITPFNYPLFDAVNK
1ad3A           SDLGK--NEWTSYYEEVAHVLEELDKELPDWAEDEPVAKTRQTQYIHSEPLGVVLVIGAWNYPFNLTIQP
1uxvA           MNAGKAVGEVKAAVDRLRLAELDLKKIGGDYIGDWTYDTLETEGLVRREPLGVVAAITPFNYPLFDAVNK
1uxnA           MNAGKAVGEVKAAVDRLRLAELDLKKIGGDYIGDWTYDTLETEGLVRREPLGVVAAITPFNYPLFDAVNK
2vroB           ANSGTTRNDSAVDIDGGIFTLSYYEVHALRDGSAESLSKD--RSFSAQHVLGVALFINAFNFPSWGLWEK
2vroA           ANSGTTRNDSAVDIDGGIFTLSYYEVHALRDGSAESLSKD--RSFSAQHVLGVALFINAFNFPSWGLWEK
1eyyB           LETARLTGEIARTANQLRLFADYHQADTPNPTRAPLPKPDIRRQQIALGPVAVFLAFSXXXXXXXXXXXX
1eyyA           LETARLTGEIARTANQLRLFADYHQADTPNPTRAPLPKPDIRRQQIALGPVAVFLAFSXXXXXXXXXXXX
1co3B           LETARLTGEIARTANQLRLFADYHQADTPNPTRAPLPKPDIRRQQIALGPVAVFLAFSXXXXXXXXXXXX
1co3A           LETARLTGEIARTANQLRLFADYHQADTPNPTRAPLPKPDIRRQQIALGPVAVFLAFSXXXXXXXXXXXX
1o20A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
3etfD           AVPILLAGNSYLLKHAPNVTGCA-QIARILAEAGTPAGVYGWVNANNEGVSQ-INDPRIAAVTVTGSVRX
3etfC           AVPILLAGNSYLLKHAPNVTGCA-QIARILAEAGTPAGVYGWVNANNEGVSQ-INDPRIAAVTVTGSVRX
3etfB           AVPILLAGNSYLLKHAPNVTGCA-QIARILAEAGTPAGVYGWVNANNEGVSQ-INDPRIAAVTVTGSVRX
3efvC           AVPILLAGNSYLLKHAPNVTGCA-QIARILAEAGTPAGVYGWVNANNEGVSQ-INDPRIAAVTVTGSVRX
3efvA           AVPILLAGNSYLLKHAPNVTGCA-QIARILAEAGTPAGVYGWVNANNEGVSQ-INDPRIAAVTVTGSVRX
2ve5A           SAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
1a4sA           CAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPT
2ve5C           SAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
2w8nA           VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
3ifgA           VGPALAAGCPIVVKPAESTPFSALAMAFLAERAGVPKGVLSVVIGDPKAIGEITSNPIVRKLSFTGSTAV
2opxA           MAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELANPKVAMVSMTGSVSA
2hg2A           MAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELANPKVAMVSMTGSVSA
2w8pA           VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
2iluA           MAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELANPKVAMVSMTGSVSA
2w8oA           VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
1o02A           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
1o01C           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
2onnA           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
1o04A           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
1bxsA           IGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
2onmA           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
1o9jA           IGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
3b4wA           IAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSNPDIDMFTFTGSSAV
3fg0E           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKVDLVSFTGGIET
3fg0D           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKVDLVSFTGGIET
3fg0C           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKVDLVSFTGGIET
3fg0A           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKVDLVSFTGGIET
3ed6A           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKVDLVSFTGGIET
1a4zA           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEVDKVAFTGSTEV
2o2pA           TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDPDVRKIGFTGSTEV
1bi9C           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
1bi9B           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
1bi9A           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
1bi9D           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
3ek1G           AAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAREIAELTSNDTVRKLSFTGSTEV
3ek1B           AAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAREIAELTSNDTVRKLSFTGSTEV
3ek1A           AAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAREIAELTSNDTVRKLSFTGSTEV
1wnbA           XXXXXXXGNCVVLKPSEITPLTALKLAE-LAKDIFPAGVVNILFGRGKTVGDPLTGPKVRMVSLTGSIAT
1euhA           IAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGSEIGDYIVEHQVNFINFTGSTGI
2id2C           IAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGSEIGDYIVEHQVNFINFSGSTGI
2id2A           IAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGSEIGDYIVEHQVNFINFSGSTGI
2esdA           IAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGSEIGDYIVEHQVNFINFTGSTGI
1qi1A           IAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGSEIGDYIVEHQVNFINFTGSTGI
1zumC           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTG----
1t90A           FPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPV
1zumA           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
1zumE           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTG----
1zumJ           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTG----
1zumI           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTG----
1zumD           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGST--
1zumB           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN-IVPGFGPTA---------GAAIASHEDV
3i44A           VIPALLAGCTMVLKPSEIAPLSAMLFAEILDEAALPSGVFNLINGDGANVGSYLAHPDLEMISFTGSTRA
2d4eC           IAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAXXXXXXXXXXXXXXXXXX
2d4eA           IAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAXXXXXXXXXXXXXXXXXX
1zumL           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN-IVPGFGPTA---------GAAIASHEDV
1zumK           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI----------------VPGFGPT----A
3ju8A           IVPALLAGNCVVFKPSELTPKVAELTLKAWIQAGLPAGVL-NLVQGGRETGVALAAHRLDGLFFTGSSRT
2bhpA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPVGEEVGAYLVEHPRIRFINFTGSLEV
2j6lB           NAIAMICGNVCLWKGAPTTSLISVAVTKIILEDNKLPGAICSLTCGGADIGTAMADERVNLLSFTGSTQV
2j6lA           NAIAMICGNVCLWKGAPTTSLISVAVTKIILEDNKLPGAICSLTCGGADIGTAMADERVNLLSFTGSTQV
1uzbA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPVGEEVGAYLVEHPRIRFINFTGSLEV
2jg7A           NAIALTCGNVCLWKGAPTTPLTSVAVTKIVLEQNNLPGAICSMTCGGADIGTAMADERVDLLSFTGSTHV
2bjaA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPVGEEVGAYLVEHPRIRFINFTGSLEV
1ky8A           ITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGKEAEKIVADDRVAAVSFTGS--T
1ad3A           MVGAVAAGNAVILK-PSEVSGHMADLLATLIPQYMDQNLYLVVKGGVPETTELLKE-RFDHIMYTGSTAV
1uxvA           ITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGKEAEKIVADDRVAAVSFTGS--T
1uxnA           ITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGKEAEKIVADDRVAAVSFTGS--T
2vroB           AAPALLSGVPVIVKPATATAWLTQRMVADVVDAGLPPGALSIICGSSAGLLDQIRSFDVVSFTGSADTAA
2vroA           AAPALLSGVPVIVKPATATAWLTQRMVADVVDAGLPPGALSIICGSSAGLLDQIRSFDVVSFTGSADTAA
1eyyB           XCPVIVKGHTAHPGTSQIVAEC---IEQALKQEQLPQAIF-TLLQGNQRALALVSHPEIKAVGFTGSVGG
1eyyA           XCPVIVKGHTAHPGTSQIVAEC---IEQALKQEQLPQAIF-TLLQGNQRALALVSHPEIKAVGFTGSVGG
1co3B           XCPVIVKGHTAHPGTSQIVAEC---IEQALKQEQLPQAIF-TLLQGNQRALALVSHPEIKAVGFTGSVGG
1co3A           XCPVIVKGHTAHPGTSQIVAEC---IEQALKQEQLPQAIF-TLLQGNQRALALVSHPEIKAVGFTGSVGG
1o20A           ---ALKSGNTILLRGGSDALNSNKAIVSAIREALKETEIPESSVEFIENTDRLVLEIRLREYLSLVIPRG


                         .         .         .         +         .         .         .:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
3etfD           XXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
3etfC           XXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
3etfB           XXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
3efvC           XXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
3efvA           XXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
2ve5A           GKKVASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEA
1a4sA           GKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLE
2ve5C           GKKVASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVTNGTRVFIHRSQQA-RFEA
2w8nA           GKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVK
3ifgA           GRLLMAQSAPTVKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFAD
2opxA           GEKIMATAAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVN
2hg2A           GEKIMATAAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVN
2w8pA           GKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTAVCSNQFLVQRGIHDAFVK
2iluA           GEKIMATAAKNITK-VLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVN
2w8oA           GKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVK
1o02A           GRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1o01C           GRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
2onnA           GRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1o04A           GRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCSCAGSRTFVQEDIYDEFVE
1bxsA           GKLIKEAAGKNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVR
2onmA           GRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1o9jA           GKMIQEAAAKNLKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQ
3b4wA           GREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVA
3fg0E           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
3fg0D           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
3fg0C           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
3fg0A           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
3ed6A           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
1a4zA           GHLIQVAAGKNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVE
2o2pA           GKHIMKCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQ
1bi9C           GKLIQEAAGRNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1bi9B           GKLIQEAAGRNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1bi9A           GKLIQEAAGRNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1bi9D           GKLIQEAAGRNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
3ek1G           GRLLAQCAPT-IKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAGQTCVCANRIYVQRGVYDKFXX
3ek1B           GRLLAQCAPT-IKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAGQTCVCANRIYVQRGVYDKFXX
3ek1A           GRLLAQCAPT-IKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAGQTCVCANRIYVQRGVYDKFXX
1wnbA           GEHIISHTASSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVE
1euhA           GERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVE
2id2C           GERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVE
2id2A           GERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVE
2esdA           GERIGKMAG--MRPIMLALGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVE
1qi1A           GERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRSTAVKRVLVMESVADELVE
1zumC           ------------KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1t90A           GEYVYKKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMA
1zumA           GRVI------QVARVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumE           ------------KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumJ           -------------RVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumI           -------------RVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumD           -------------RVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumB           DK---------VAFVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
3i44A           GKDISKNASNTLKRVCLELGGKGANXXXXXXXXXX-LQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIK
2d4eC           XXKIVRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVG
2d4eA           XXKIVRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVG
1zumL           D-KVA------FTRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
1zumK           GAAIAS----HEDVDKVAFTGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE
3ju8A           GNLLHSQFGGQPQKILALEGGNNPXXXXXXXXXXXXXYTIIQSAFISAGQRCTCARRLLVPQGAGDALLA
2bhpA           GLKIYEAAGRWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLE
2j6lB           GKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVN
2j6lA           GKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVN
1uzbA           GLKIYEAAGRWFKRAYVETGGKNAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLE
2jg7A           GKMVAMMVQERFGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVVE
2bjaA           GLKIYEAAGRWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKS-AASRLILTQGAYEPVLE
1ky8A           XXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAGQRCDAIKLVLAERPVYGKLVE
1ad3A           GKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVE
1uxvA           XXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAGQRCDAIKLVLAERPVYGKLVE
1uxnA           XXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAGQRCDAIKLVLAERPVYGKLVE
2vroB           TLRAHPAFVQRGARLNVEADSLNSAILCADATFDLFIKEVVREMTVKSGQKCTAIRRAFVPEAALEPVLE
2vroA           TLRAHPAFVQRGARLNVEADSLNSAILCADATFDLFIKEVVREMTVKSGQKCTAIRRAFVPEAALEPVLE
1eyyB           GRALFNLAHERPEPIPFELGAINPTFIFPSAMRAKAADQFVASMTMGCGQFC--TKPGVVFALNTPET--
1eyyA           GRALFNLAHERPEPIPFELGAINPTFIFPSAMRAKAADQFVASMTMGCGQFC--TKPGVVFALNTPET--
1co3B           GRALFNLAHERPEPIPFELGAINPTFIFPSAMRAKAADQFVASMTMGCGQFC--TKPGVVFALNTPET--
1co3A           GRALFNLAHERPEPIPFELGAINPTFIFPSAMRAKAADQFVASMTMGCGQFC--TKPGVVFALNTPET--
1o20A           GYGLISFVRDNATVPVLETGVGNCHIFVDEADLKKAVPVIINAKTQRPG-TCNAAEKLLVHEKIAKEFL-


                         .         *         .         .         .         .         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
3etfD           RFVXXXXXLK-GDPLVEENDLGP-ARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
3etfC           RFVXXXXXLK-GDPLVEENDLGP-ARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
3etfB           RFVXXXXXLK-GDPLVEENDLGP-ARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
3efvC           RFVXXXXXLK-GDPLVEENDLGP-ARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
3efvA           RFVXXXXXLK-GDPLVEENDLGP-ARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
2ve5A           KVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTGKGAYVAPTVFTDCR
1a4sA           EVVKRTKAIVVGDPLLTETRMGGLPQLDKVLGF---VAQAKKEGARVLCGGEPLTPSGYFMSPCVLDNCR
2ve5C           KVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTGKGAYVAPTVFTDCR
2w8nA           AFEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVT
3ifgA           KLAAAVSKLKVGRGTESGATLGPLINEAAVKKVESHIADALAKGASLMTGGKRHALGHGFFEPTVLTGVK
2opxA           RLGEAMQAVQFGNPAENDIAMGPLINAAALERVEQKXXXXXXXXXXXXLGGKAVEGKGYYYPPTLLLDVR
2hg2A           RLGEAMQAVQFGNPAENDIAMGPLINAAALERVEQKXXXXXXXXXXXXFGGKAVEGKGYYYPPTLLLDVR
2w8pA           AFEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVT
2iluA           RLGEAMQAVQFGNPAENDIAMGPLINAAALERVEQKXXXXXXXXXXXXFGGKAVEGKGYYYPPTLLLDVR
2w8oA           AFEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVT
1o02A           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1o01C           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
2onnA           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1o04A           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1bxsA           RSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVT
2onmA           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1o9jA           RSVERAKKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVT
3b4wA           AVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRPEGNGFFIQPTVFADVD
3fg0E           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGAIAVGGKRPDRDDGLFFEPTVITNCD
3fg0D           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGAIAVGGKRPDRDDGLFFEPTVITNCD
3fg0C           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGAIAVGGKRPDRDDGLFFEPTVITNCD
3fg0A           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGAIAVGGKRPDRDDGLFFEPTVITNCD
3ed6A           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGAIAVGGKRPDRDDGLFFEPTVITNCD
1a4zA           RSVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSXXXXXXXXXXXXXXXXDRGYFIQPTVFGDLQ
2o2pA           XXXXXXXXXXIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE
1bi9C           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1bi9B           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1bi9A           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1bi9D           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
3ek1G           XXXXXXXXXXXGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKEL--GGLFFEPGILTGVT
3ek1B           XXXXXXXXXXXGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKEL--GGLFFEPGILTGVT
3ek1A           XXXXXXXXXXXGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKEL--GGLFFEPGILTGVT
1wnbA           KLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIVITGGEKRKGNGYYYAPTLLAGAL
1euhA           KIREKVLALTIGNPEDDATPLIDTKSADYVEGL---INDANDKGATALT---EIKREGNLICPILFDKVT
2id2C           KIREKVLALTIGNPEDDATPLIDTKSADYVEGL---INDANDKGATALT---EIKREGNLICPILFDKVT
2id2A           KIREKVLALTIGNPEDDATPLIDTKSADYVEGL---INDANDKGATALT---EIKREGNLICPILFDKVT
2esdA           KIREKVLALTIGNPEDDATPLIDTKSADYVEGL---INDANDKGATALT---EIKREGNLICPILFDKVT
1qi1A           KIREKVLALTIGNPEDDATPLIDTKSADYVEGL---INDANDKGATALT---EIKREGNLICPILFDKVT
1zumC           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1t90A           KLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCGRENVSDDGYFVGPTIFDNVT
1zumA           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumE           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumJ           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumI           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumD           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumB           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
3i44A           TAKDIAEKTQVGPGHQTGNHIGPVVSKEQYDKIQDLIQSGIDEGATLVTGGTGLPERGYYVRPTVFADVK
2d4eC           KVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKSRGNYLLPTVFVG-E
2d4eA           KVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKSRGNYLLPTVFVG-E
1zumL           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
1zumK           RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
3ju8A           RLVAVSATLRVGRFDEQPAPFGAVISLSAAEHLLKAQEHLIGKGAQPLLATQPIDG-AALLTPGILD-VS
2bhpA           RVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGG-KRLEGEGYFIAPTVFTEVP
2j6lB           RLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLG
2j6lA           RLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLG
1uzbA           RVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGG-KRLEGEGYFIAPTVFTEVP
2jg7A           RIAKAYKQVRIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGKVMDRPGNYVEPTIITGLA
2bjaA           RVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGG-KRLEGEGYFIAPTVFTEVP
1ky8A           EVAKRLSSLRVGDPRDPTVDVGPL----ISPSAVDEMMAAIEDAVXXXXXXXXXXXXPTYVQPTLVDRVK
1ad3A           KLKKSLKDFYGEDAKQSR----DYGRI-INDRHFQRVKGLIDNQKVAHGG--TWDQSSRYIAPTILVDVD
1uxvA           EVAKRLSSLRVGDPRDPTVDVGPL----ISPSAVDEMMAAIEDAVXXXXXXXXXXXXPTYVQPTLVDRVK
1uxnA           EVAKRLSSLRVGDPRDPTVDVGPL----ISPSAVDEMMAAIEDAVXXXXXXXXXXXXPTYVQPTFVDRVK
2vroB           ALKAKLAKITVGNPRNDAVRMGSLVSREQYENVLAGIAALREEAVLAYSSAVPLANIAACVAPHLFVVND
2vroA           ALKAKLAKITVGNPRNDAVRMGSLVSREQYENVLAGIAALREEAVLAYSSAVPLANIAACVAPHLFVVND
1eyyB           --QAFIETAQS---LIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQPCVASALFVTSSENWRKH
1eyyA           --QAFIETAQS---LIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQPCVASALFVTSSENWRKH
1co3B           --QAFIETAQS---LIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQPCVASALFVTSSENWRKH
1co3A           --QAFIETAQS---LIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQPCVASALFVTSSENWRKH
1o20A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PGMPAFDEELFGPVAAIIRXXXXXXXXXXXXXSRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
3etfD           PD-TAFRQELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-AARLECGGVFINGYSASD
3etfC           PD-TAFRQELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-AARLECGGVFINGYSASD
3etfB           PD-TAFRQELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-AARLECGGVFINGYSASD
3efvC           PD-TAFRQELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-AARLECGGVFINGYSASD
3efvA           PD-TAFRQELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-AARLECGGVFINGYSASD
2ve5A           DDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESP
1a4sA           DDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVAANLEAGTCYINTYSISP
2ve5C           DDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESP
2w8nA           QDMLCTHEETFGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISS
3ifgA           PDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRVAEALEYGMVGINTGLISN
2opxA           QEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEA
2hg2A           QEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEA
2w8pA           QDMLCTHEETFGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISS
2iluA           QEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEA
2w8oA           QDMLT-----FGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISS
1o02A           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1o01C           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
2onnA           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1o04A           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1bxsA           DDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVS
2onmA           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1o9jA           DDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSALQAGTVWVNCYLAAS
3b4wA           NKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYA-FD
3fg0E           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
3fg0D           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
3fg0C           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
3fg0A           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
3ed6A           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
1a4zA           DGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
2o2pA           DHMYIAKEESFGPIMIISRDGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTD
1bi9C           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
1bi9B           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
1bi9A           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
1bi9D           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
3ek1G           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
3ek1B           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
3ek1A           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
1wnbA           QDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTWVNTHFMLV
1euhA           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTRGT
2id2C           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTRGT
2id2A           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTRGT
2esdA           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTRGT
1qi1A           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTRGT
1zumC           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1t90A           TEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFRENIDAGMLGINGVPAPM
1zumA           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVN------
1zumE           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1zumJ           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1zumI           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1zumD           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1zumB           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
3i44A           PHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRIAAQVRSGMVEVNG-----
2d4eC           NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTXXXXXXXXXXXXXXXGMVYLNSHNVRH
2d4eA           NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTXXXXXXXXXXXXXXXGMVYLNSHNVRH
1zumL           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1zumK           DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLSQALQAGTVWVN------
3ju8A           AVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGLAAGLLSDSRERFEQFLVESRAGIVNWNQLTGAA
2bhpA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGA
2j6lB           HDASIAHTETFAPILYVFKFQNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWPKGSDCGIVNVN-IPTSG
2j6lA           HDASIAHTETFAPILYVFKFQNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWPKGSDCGIVNVN-IPTSG
1uzbA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGA
2jg7A           HDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDLGRVFRWPKGSDCGIVNVN-IPTSG
2bjaA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGA
1ky8A           -DMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINDMPRHG
1ad3A           PQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMIAETSSGGVTANDVIVTV
1uxvA           -DMVLYKREVFAPVALAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINDMPRHG
1uxnA           -DMVLYKREVFAPVALAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINDMPRHG
2vroB           PDNATLDVEVFGPVASVVTALPEAHAVALARRGQGSLVASIYSNDDAHLGRLALEL--------------
2vroA           PDNATLDVEVFGPVASVAPTTDTLPEAHAVALARRGQGASIYSNDDAHLGRLALEL--------------
1eyyB           P---AWEEEIFGPQSLIV----------------------------------------------------
1eyyA           P---AWEEEIFGPQSLIV----------------------------------------------------
1co3B           P---AWEEEIFGPQSLIV----------------------------------------------------
1co3A           P---AWEEEIFGPQSLIV----------------------------------------------------
1o20A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK
3etfD           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVW--
3etfC           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVW--
3etfB           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVW--
3efvC           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVW--
3efvA           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVW--
2ve5A           AEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVE
1a4sA           VEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE
2ve5C           AEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVE
2w8nA           VECPFGGVKQSGLGREGSKYGIDEYLELK-----
3ifgA           EVAPFGGVKQSGLGREGSHYGIDDYVVIKYLCV-
2opxA           MQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQ
2hg2A           MQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQ
2w8pA           VECPFGGVKQSGLGREGSKYGIDEYLELK-----
2iluA           MQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQ
2w8oA           VECPFGGVKQSGLGREGSKYGIDEYLELK-----
1o02A           AQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVK
1o01C           AQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVK
2onnA           AQSPFGGYKMSGSGQELGEYGLQAYTEVKTVTVK
1o04A           AQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVK
1bxsA           AQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIK
2onmA           AQSPFGGYKMSGSGRELGEYGLQAY---------
1o9jA           AQSPAGGFKMSGHGREMGEYGIHEYTEVKTVTMK
3b4wA           PGSPFGGYKNSGIGRENGPEGVEHFTQQKSV---
3fg0E           AQAPWGGYKQSGIGRELGKEGLEEYLVSK-----
3fg0D           AQAPWGGYKQSGIGRELGKEGLEEYLVSK-----
3fg0C           AQAPWGGYKQSGIGRELGKEGLEEYLVSK-----
3fg0A           AQAPWGGYKQSGIGRELGKEGLEEYLVSK-----
3ed6A           AQAPWGGYKQSGIGRELGKEGLEEYLVSK-----
1a4zA           AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVR
2o2pA           VAAPFGGFKQSGFGKDLGEAALNEYLRIKTV---
1bi9C           ---------CYNAGE----FGLREYSEVKTVTVK
1bi9B           ---------CYGE------FGLREYSEVKTVTVK
1bi9A           ---------CYGE------FGLREYSEVKTVTVK
1bi9D           ---------C--YNALNGEFGLREYSEVKTVTVK
3ek1G           EVAPFGGVKQSGLGREGSKYGIEEYLETK-----
3ek1B           EVAPFGGVKQSGLGREGSKYGIEEYLETK-----
3ek1A           EVAPFGGVKQSGLGREGSKYGIEEYLETK-----
1wnbA           SEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVK
1euhA           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSV---
2id2C           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSV---
2id2A           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSV---
2esdA           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSV---
1qi1A           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSV---
1zumC           AQSPFGGRELGEYG--------------------
1t90A           AFFPFSGWKSSFFG--------------------
1zumA           ----------------------------------
1zumE           AQSPFGGY------RELGEYGLQAY---------
1zumJ           AQSPFGGYELGEYG--------------------
1zumI           AQSPFGGY------RELGEYGLQAY---------
1zumD           AQSPFGG---------------------------
1zumB           AQSPFGG------GRELGEYGLQAY---------
3i44A           HELPFGGVKFSGRAREGGLWGIKEFLDTKAI---
2d4eC           LPTPFGGVKGSGDRREGGTYALDFYTDLKTI---
2d4eA           LPTPFGGVKGSGDRREGGTYALDFYTDLKTI---
1zumL           AQSPFLG---------------------------
1zumK           ----------------------------------
3ju8A           SSAPFGGIGASGNHRPSAYY--------------
2bhpA           GVQPFGGFKLSG----------------------
2j6lB           AEIAFGGEKHTGGGRESGSDAWKQYMRRSTCTI-
2j6lA           AEIAFGGEKHTGGGRESGSDAWKQYMRRSTCTI-
1uzbA           GVQPFGGFKLSG----------------------
2jg7A           AEIAFGGEKHTGGGRESGSDSWKQYMRRSTCTI-
2bjaA           GVQPFGGFKLSG----------------------
1ky8A           GYYPFGGRKKSGVFREGIGYAVEAVTAYKTI---
1ad3A           PTLPFGGVGNSGMG---AYHGKKSF---------
1uxvA           GYYPFGGRKKSGVFREGIGYAVEAVTAYKTI---
1uxnA           GYYPFGGRKKSGVFREGIGYAVEAVTAYKTI---
2vroB           ----------------------------------
2vroA           ----------------------------------
1eyyB           ----------------------------------
1eyyA           ----------------------------------
1co3B           ----------------------------------
1co3A           ----------------------------------
1o20A           ----------------------------------