[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA57113.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g5bB.bssp"
#ERROR : Can't open dsspfile "1g5bA.bssp"
#ERROR : Can't open dsspfile "2qjcA.bssp"
#ERROR : Can't open dsspfile "2dfjA.bssp"
#ERROR : Can't open dsspfile "1s70A.bssp"
#ERROR : Can't open dsspfile "1u32A.bssp"
#ERROR : Can't open dsspfile "2o8aA.bssp"
#ERROR : Can't open dsspfile "1jk7A.bssp"
#ERROR : Can't open dsspfile "1it6A.bssp"
#ERROR : Can't open dsspfile "1fjmB.bssp"
#ERROR : Can't open dsspfile "1fjmA.bssp"
#ERROR : Can't open dsspfile "3e7bA.bssp"
#ERROR : Can't open dsspfile "3e7aA.bssp"
#ERROR : Can't open dsspfile "2bcdA.bssp"
#ERROR : Can't open dsspfile "1wao4.bssp"
#ERROR : Can't open dsspfile "1wao2.bssp"
#ERROR : Can't open dsspfile "1wao1.bssp"
#ERROR : Can't open dsspfile "1s95B.bssp"
#ERROR : Can't open dsspfile "1s95A.bssp"
#ERROR : Can't open dsspfile "3h64D.bssp"
#ERROR : Can't open dsspfile "3h64A.bssp"
#ERROR : Can't open dsspfile "3h61A.bssp"
#ERROR : Can't open dsspfile "1tcoA.bssp"
#ERROR : Can't open dsspfile "2p6bA.bssp"
#ERROR : Can't open dsspfile "1mf8A.bssp"
#ERROR : Can't open dsspfile "1m63E.bssp"
#ERROR : Can't open dsspfile "1m63A.bssp"
#ERROR : Can't open dsspfile "2jogA.bssp"
#ERROR : Can't open dsspfile "1auiA.bssp"
#ERROR : Can't open dsspfile "2nylC.bssp"
#ERROR : Can't open dsspfile "2nppC.bssp"
#ERROR : Can't open dsspfile "2ie3C.bssp"
#ERROR : Can't open dsspfile "3c5wC.bssp"

## Summary of PDB Search
:228
    2e-30  38%  1g5bB  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE
    2e-30  38%  1g5bA  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE
    1e-10  43%  2qjcA  [x.x.x] DIADENOSINE TETRAPHOSPHATASE, PUTATIVE
    2e-09  44%  2dfjA  [x.x.x] DIADENOSINETETRAPHOSPHATASE
    1e-07  46%  1s70A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-BETA
    2e-07  46%  1u32A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA
    2e-07  46%  2o8aA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA
    2e-07  46%  1jk7A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA
    2e-07  46%  1it6A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE 1 GAMMA
    2e-07  46%  1fjmB  [d.159.1] PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA
    2e-07  46%  1fjmA  [d.159.1] PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA
    2e-07  46%  3e7bA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA
    2e-07  46%  3e7aA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA
    2e-07  46%  2bcdA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA
    4e-06  40%  1wao4  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    4e-06  40%  1wao2  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    4e-06  40%  1wao1  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    4e-06  40%  1s95B  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    4e-06  40%  1s95A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    4e-06  40%  3h64D  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 5
    4e-06  40%  3h64A  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 5
    4e-06  40%  3h61A  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 5
    7e-05  44%  1tcoA  [d.159.1] SERINE/THREONINE PHOSPHATASE B2
    7e-05  44%  2p6bA  [x.x.x] CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT ALPHA
    7e-05  44%  1mf8A  [d.159.1] CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT,
    7e-05  44%  1m63E  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE 2B
    7e-05  44%  1m63A  [d.159.1] SERINE/THREONINE PROTEIN PHOSPHATASE 2B
    7e-05  44%  2jogA  [x.x.x] CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT ALPHA
    7e-05  44%  1auiA  [d.159.1] SERINE/THREONINE PHOSPHATASE 2B
    3e-04  26%  2nylC  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    3e-04  26%  2nppC  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    3e-04  26%  2ie3C  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    3e-04  26%  3c5wC  [x.x.x] PP2A C SUBUNIT
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
1g5bB           ----RYYEKIDGSKYVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRA
1g5bA           ----RYYEKIDGSKYVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRA
2qjcA           --------NVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAYS
2dfjA           --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
1s70A           ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
1u32A           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
2o8aA           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
1jk7A           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
1it6A           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
1fjmB           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
1fjmA           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
3e7bA           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
3e7aA           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
2bcdA           ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
1wao4           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
1wao2           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
1wao1           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
1s95B           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
1s95A           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
3h64D           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
3h64A           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
3h61A           ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
1tcoA           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
2p6bA           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
1mf8A           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
1m63E           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
1m63A           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
2jogA           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
1auiA           ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
2nylC           ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
2nppC           ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
2ie3C           ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
3c5wC           ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI


                         .         .         *         .         .         .         .:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
1g5bB           VRGNHEQMMIDGLSERGNVNHWLL-NGGGWFFNLDYDKEILLAHKADELPLIIELVSKDKKYVICHADYP
1g5bA           VRGNHEQMMIDGLSERGNVNHWLL-NGGGWFFNLDYDKEILLAHKADELPLIIELVSKDKKYVICHADYP
2qjcA           VLGNHD----------------------------------------------------------------
2dfjA           VLGNHD----------------------------------------------------------------
1s70A           LRGNHECASIN-----------------------------------------------------------
1u32A           LRGNHECASIN-----------------------------------------------------------
2o8aA           LRGNHECASIN-----------------------------------------------------------
1jk7A           LRGNHECASIN-----------------------------------------------------------
1it6A           LRGNHECASIN-----------------------------------------------------------
1fjmB           LRGNHECASIN-----------------------------------------------------------
1fjmA           LRGNHECASIN-----------------------------------------------------------
3e7bA           LRGNHECASIN-----------------------------------------------------------
3e7aA           LRGNHECASIN-----------------------------------------------------------
2bcdA           LRGNHECASIN-----------------------------------------------------------
1wao4           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
1wao2           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
1wao1           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
1s95B           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
1s95A           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
3h64D           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
3h64A           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
3h61A           LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
1tcoA           LRGNHE----------------------------------------------------------------
2p6bA           LRGNHE----------------------------------------------------------------
1mf8A           LRGNHE----------------------------------------------------------------
1m63E           LRGNHE----------------------------------------------------------------
1m63A           LRGNHE----------------------------------------------------------------
2jogA           LRGNHE----------------------------------------------------------------
1auiA           LRGNHE----------------------------------------------------------------
2nylC           LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
2nppC           LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
2ie3C           LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
3c5wC           LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS


                         +         .         .         .         .         *         .:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAA
1g5bB           FD--------EYEFGKPVDHQQVIWNRERISNSIVKEIKGADTFIFGHTAVK--PLKFANQMY-IDTGAV
1g5bA           FD--------EYEFGKPVDHQQVIWNRERISNSIVKEIKGADTFIFGHTAVK--PLKFANQMY-IDTGAV
2qjcA           ----------------------------------------------------------------------
2dfjA           ----------------------------------------------------------------------
1s70A           ----------------------------------------------------------------------
1u32A           ----------------------------------------------------------------------
2o8aA           ----------------------------------------------------------------------
1jk7A           ----------------------------------------------------------------------
1it6A           ----------------------------------------------------------------------
1fjmB           ----------------------------------------------------------------------
1fjmA           ----------------------------------------------------------------------
3e7bA           ----------------------------------------------------------------------
3e7aA           ----------------------------------------------------------------------
2bcdA           ----------------------------------------------------------------------
1wao4           ----------------------------------------------------------------------
1wao2           ----------------------------------------------------------------------
1wao1           ----------------------------------------------------------------------
1s95B           ----------------------------------------------------------------------
1s95A           ----------------------------------------------------------------------
3h64D           ----------------------------------------------------------------------
3h64A           ----------------------------------------------------------------------
3h61A           ----------------------------------------------------------------------
1tcoA           ----------------------------------------------------------------------
2p6bA           ----------------------------------------------------------------------
1mf8A           ----------------------------------------------------------------------
1m63E           ----------------------------------------------------------------------
1m63A           ----------------------------------------------------------------------
2jogA           ----------------------------------------------------------------------
1auiA           ----------------------------------------------------------------------
2nylC           PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
2nppC           PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
2ie3C           PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
3c5wC           PSIDTLDHIRALDRLQEVPHE-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           Yxxxxxxxxxxxxxxxxx
1g5bB           F-----------------
1g5bA           F-----------------
2qjcA           ------------------
2dfjA           ------------------
1s70A           ------------------
1u32A           ------------------
2o8aA           ------------------
1jk7A           ------------------
1it6A           ------------------
1fjmB           ------------------
1fjmA           ------------------
3e7bA           ------------------
3e7aA           ------------------
2bcdA           ------------------
1wao4           ------------------
1wao2           ------------------
1wao1           ------------------
1s95B           ------------------
1s95A           ------------------
3h64D           ------------------
3h64A           ------------------
3h61A           ------------------
1tcoA           ------------------
2p6bA           ------------------
1mf8A           ------------------
1m63E           ------------------
1m63A           ------------------
2jogA           ------------------
1auiA           ------------------
2nylC           ------------------
2nppC           ------------------
2ie3C           ------------------
3c5wC           ------------------