[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA57498.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ywiB.bssp"
#ERROR : Can't open dsspfile "2ywiA.bssp"
#ERROR : Can't open dsspfile "2cvbA.bssp"
#ERROR : Can't open dsspfile "3c71A.bssp"
#ERROR : Can't open dsspfile "3c73B.bssp"
#ERROR : Can't open dsspfile "3c73A.bssp"
#ERROR : Can't open dsspfile "1st9A.bssp"
#ERROR : Can't open dsspfile "2h1bC.bssp"
#ERROR : Can't open dsspfile "2h1bA.bssp"
#ERROR : Can't open dsspfile "2f9sA.bssp"
#ERROR : Can't open dsspfile "2h19B.bssp"
#ERROR : Can't open dsspfile "2h19A.bssp"
#ERROR : Can't open dsspfile "1su9B.bssp"
#ERROR : Can't open dsspfile "1su9A.bssp"
#ERROR : Can't open dsspfile "1st9B.bssp"
#ERROR : Can't open dsspfile "2h1gB.bssp"
#ERROR : Can't open dsspfile "2h1gA.bssp"
#ERROR : Can't open dsspfile "2h1aB.bssp"
#ERROR : Can't open dsspfile "2h1aA.bssp"
#ERROR : Can't open dsspfile "2f9sB.bssp"

## Summary of PDB Search
:193
    8e-58  60%  2ywiB  [x.x.x] HYPOTHETICAL CONSERVED PROTEIN
    8e-58  60%  2ywiA  [x.x.x] HYPOTHETICAL CONSERVED PROTEIN
    2e-39  47%  2cvbA  [x.x.x] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    2e-07  27%  3c71A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-07  29%  3c73B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-07  29%  3c73A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-06  27%  1st9A  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-06  27%  2h1bC  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-06  27%  2h1bA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    3e-06  29%  2f9sA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-06  26%  2h19B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-06  26%  2h19A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  26%  1su9B  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  26%  1su9A  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  26%  1st9B  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  27%  2h1gB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  27%  2h1gA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  27%  2h1aB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-06  27%  2h1aA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-05  29%  2f9sB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
2ywiB           ----------LGKQAPPFALTNVIDGNVVRLEDVK-SDAATVIFICNHCPFVKHVQHELVRLANDY-PKG
2ywiA           ----------LGKQAPPFALTNVIDGNVVRLEDVK-SDAATVIFICNHCPFVKHVQHELVRLANDY-PKG
2cvbA           --------LPLESPLIDAELPDPRGGR-YRLSQFHEP--LLAVVFCNHCPYVKGSIGELVALAERYRGK-
3c71A           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCPHCKKEFPYMANQYKHFKSQG
3c73B           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWWCEHCK--KEFPYMANQY-KHFKSQG
3c73A           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWWCEHCK--KEFPYMANQY-KHFKSQG
1st9A           -----------GSDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
2h1bC           -----------GSDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKQFPYMANQYKHFKSQG
2h1bA           -----------GSDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKQFPYMANQYKHFKSQG
2f9sA           -----------GSDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYANQY-KHFKSQG
2h19B           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPAKKEFPYMANQYKHFKSQG
2h19A           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPAKKEFPYMANQYKHFKSQG
1su9B           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
1su9A           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
1st9B           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
2h1gB           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWGTWAEPAKKEFPYMANQY-KHFKSQG
2h1gA           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWGTWAEPAKKEFPYMANQY-KHFKSQG
2h1aB           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWGTWAEPCKKEFPYMANQY-KHFKSQG
2h1aA           ------------SDAPNF-VLEDTNGKRIELSDLKGKGVFLNFWGTWAEPCKKEFPYMANQY-KHFKSQG
2f9sB           ------------SDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYANQY-KHFKSQG


                         .         .         *         .         .         .         .:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
2ywiB           VSFVAINSNDAEQYPEDSPEKVAEEL---GYPFPYLYDETQEVAKAYDAACTPDFYIFDRDLKCVYRGQL
2ywiA           VSFVAINSNDAEQYPEDSPEKVAEEL---GYPFPYLYDETQEVAKAYDAACTPDFYIFDRDLKCVYRGQL
2cvbA           VAFVGINANDYEKYPEDAPEKAAF-AEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRV
3c71A           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
3c73B           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
3c73A           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
1st9A           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1bC           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1bA           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2f9sA           VEIVAVNVGE---------SKIAHNFKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h19B           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h19A           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
1su9B           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
1su9A           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
1st9B           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1gB           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1gA           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1aB           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2h1aA           VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
2f9sB           VEIVAVNVGE---------SKIAHNFKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------


                         +         .         .         .         .         *         .:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNEPDxxx
2ywiB           DDSRPNNGIPVTGESIRAALDALLEGRPVPEKQKPSIGCSIKWKP--------
2ywiA           DDSRPNNGIPVTGESIRAALDALLEGRPVPEKQKPSIGCSIKWKP--------
2cvbA           NDN-PKDPSKVQSHDLEAAIEALLRGEEPPLKEAPAIGCTIKWRPGNEPE---
3c71A           -----------------------------------------------------
3c73B           -----------------------------------------------------
3c73A           -----------------------------------------------------
1st9A           -----------------------------------------------------
2h1bC           -----------------------------------------------------
2h1bA           -----------------------------------------------------
2f9sA           -----------------------------------------------------
2h19B           -----------------------------------------------------
2h19A           -----------------------------------------------------
1su9B           -----------------------------------------------------
1su9A           -----------------------------------------------------
1st9B           -----------------------------------------------------
2h1gB           -----------------------------------------------------
2h1gA           -----------------------------------------------------
2h1aB           -----------------------------------------------------
2h1aA           -----------------------------------------------------
2f9sB           -----------------------------------------------------