[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA57747.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v54C.bssp"
#ERROR : Can't open dsspfile "1occC.bssp"
#ERROR : Can't open dsspfile "1fftC.bssp"
#ERROR : Can't open dsspfile "2dysC.bssp"
#ERROR : Can't open dsspfile "1m56C.bssp"

## Summary of PDB Search
:214
    4e-12  31%  1v54C  [f.25.1] CYTOCHROME C OXIDASE POLYPEPTIDE III
    8e-12  31%  1occC  [f.25.1] CYTOCHROME C OXIDASE
    6e-11  25%  1fftC  [f.25.1] UBIQUINOL OXIDASE
    6e-11  28%  2dysC  [x.x.x] CYTOCHROME C OXIDASE SUBUNIT 3
    4e-07  32%  1m56C  [f.25.1] CYTOCHROME C OXIDASE
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASRHTDIVLGTIS
1v54C           ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
1occC           ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
1fftC           ------------------------GFWIYLMSDCILFSILFATYAVL-VNGTAGGPTGKDIFELPFVLVE
2dysC           ------------------------GMILFIISVLFFTGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
1m56C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TGVLLTSGFTMALAVRSAKLGRDKAIIGXXXXXXXXXXXXXXXEGTEYYQAYGEQLIPAFNFMYEGAHEK
1v54C           TSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
1occC           TSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
1fftC           TFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFI---GMEIYE---------FHHLIVNGMGP
2dysC           TSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
1m56C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PVELFFFLYFLMTGMHAVHVTXXXXXXXXXXXXXXRRRFTSYYYTPVELTGLYWAFVDIVWIFLYPLFYL
1v54C           T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
1occC           T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWHFVDVVWLFLYVSIY-
1fftC           DRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL
2dysC           T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
1m56C           --------FFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYI


                         .         .         .         +         .         .         .:280
query           Vxxx
1v54C           ----
1occC           ----
1fftC           M---
2dysC           ----
1m56C           ----