[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA57806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1prxB.bssp"
#ERROR : Can't open dsspfile "1prxA.bssp"
#ERROR : Can't open dsspfile "2v2gD.bssp"
#ERROR : Can't open dsspfile "2v2gB.bssp"
#ERROR : Can't open dsspfile "2v2gA.bssp"
#ERROR : Can't open dsspfile "2v41C.bssp"
#ERROR : Can't open dsspfile "1xccB.bssp"
#ERROR : Can't open dsspfile "1xccA.bssp"
#ERROR : Can't open dsspfile "1xccD.bssp"
#ERROR : Can't open dsspfile "2e2gB.bssp"
#ERROR : Can't open dsspfile "2e2gC.bssp"
#ERROR : Can't open dsspfile "2e2gA.bssp"
#ERROR : Can't open dsspfile "1x0rA.bssp"
#ERROR : Can't open dsspfile "1vgsE.bssp"
#ERROR : Can't open dsspfile "1vgsD.bssp"
#ERROR : Can't open dsspfile "1vgsA.bssp"
#ERROR : Can't open dsspfile "2e2mC.bssp"
#ERROR : Can't open dsspfile "2nvlB.bssp"
#ERROR : Can't open dsspfile "2nvlC.bssp"
#ERROR : Can't open dsspfile "2e2mH.bssp"
#ERROR : Can't open dsspfile "2zctD.bssp"
#ERROR : Can't open dsspfile "2zctH.bssp"
#ERROR : Can't open dsspfile "2zctG.bssp"
#ERROR : Can't open dsspfile "2zctE.bssp"
#ERROR : Can't open dsspfile "2zctC.bssp"
#ERROR : Can't open dsspfile "2zctB.bssp"
#ERROR : Can't open dsspfile "2zctA.bssp"
#ERROR : Can't open dsspfile "2e2mE.bssp"
#ERROR : Can't open dsspfile "2e2mD.bssp"
#ERROR : Can't open dsspfile "2e2mA.bssp"
#ERROR : Can't open dsspfile "2cv4E.bssp"
#ERROR : Can't open dsspfile "2cv4D.bssp"
#ERROR : Can't open dsspfile "2cv4A.bssp"
#ERROR : Can't open dsspfile "1uulA.bssp"
#ERROR : Can't open dsspfile "2h01A.bssp"
#ERROR : Can't open dsspfile "2riiB.bssp"
#ERROR : Can't open dsspfile "2riiA.bssp"
#ERROR : Can't open dsspfile "2fegA.bssp"
#ERROR : Can't open dsspfile "1qmvA.bssp"
#ERROR : Can't open dsspfile "2z9sA.bssp"
#ERROR : Can't open dsspfile "1zofB.bssp"
#ERROR : Can't open dsspfile "2i81B.bssp"
#ERROR : Can't open dsspfile "2i81A.bssp"
#ERROR : Can't open dsspfile "2h66I.bssp"
#ERROR : Can't open dsspfile "3hy2B.bssp"
#ERROR : Can't open dsspfile "3hy2A.bssp"
#ERROR : Can't open dsspfile "1qq2A.bssp"
#ERROR : Can't open dsspfile "2bmxB.bssp"
#ERROR : Can't open dsspfile "2bmxA.bssp"
#ERROR : Can't open dsspfile "1zofA.bssp"
#ERROR : Can't open dsspfile "2c0dB.bssp"
#ERROR : Can't open dsspfile "2h66B.bssp"
#ERROR : Can't open dsspfile "2pn8H.bssp"
#ERROR : Can't open dsspfile "2pn8A.bssp"
#ERROR : Can't open dsspfile "2h66F.bssp"
#ERROR : Can't open dsspfile "2h66D.bssp"
#ERROR : Can't open dsspfile "2h66C.bssp"
#ERROR : Can't open dsspfile "2h66A.bssp"
#ERROR : Can't open dsspfile "2h66J.bssp"
#ERROR : Can't open dsspfile "2h66E.bssp"
#ERROR : Can't open dsspfile "2i81D.bssp"
#ERROR : Can't open dsspfile "1n8jA.bssp"
#ERROR : Can't open dsspfile "1e2yG.bssp"
#ERROR : Can't open dsspfile "2c0dA.bssp"
#ERROR : Can't open dsspfile "1zyeA.bssp"
#ERROR : Can't open dsspfile "1yepD.bssp"
#ERROR : Can't open dsspfile "1yepC.bssp"
#ERROR : Can't open dsspfile "1yepB.bssp"
#ERROR : Can't open dsspfile "1yepA.bssp"
#ERROR : Can't open dsspfile "3empB.bssp"
#ERROR : Can't open dsspfile "3empA.bssp"
#ERROR : Can't open dsspfile "1yexD.bssp"
#ERROR : Can't open dsspfile "1yexC.bssp"
#ERROR : Can't open dsspfile "1yexB.bssp"
#ERROR : Can't open dsspfile "1yexA.bssp"
#ERROR : Can't open dsspfile "1yf1C.bssp"
#ERROR : Can't open dsspfile "1yf1B.bssp"
#ERROR : Can't open dsspfile "1yf1A.bssp"
#ERROR : Can't open dsspfile "1yf0D.bssp"
#ERROR : Can't open dsspfile "1yf0C.bssp"
#ERROR : Can't open dsspfile "1yf0B.bssp"
#ERROR : Can't open dsspfile "1yf0A.bssp"
#ERROR : Can't open dsspfile "1e2yB.bssp"
#ERROR : Can't open dsspfile "1e2yC.bssp"
#ERROR : Can't open dsspfile "1e2yH.bssp"
#ERROR : Can't open dsspfile "1e2yE.bssp"
#ERROR : Can't open dsspfile "1e2yD.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "1e2yF.bssp"
#ERROR : Can't open dsspfile "1we0A.bssp"
#ERROR : Can't open dsspfile "2cx3B.bssp"
#ERROR : Can't open dsspfile "2cx3A.bssp"
#ERROR : Can't open dsspfile "3gknA.bssp"
#ERROR : Can't open dsspfile "3gkmA.bssp"
#ERROR : Can't open dsspfile "3gkkA.bssp"
#ERROR : Can't open dsspfile "3c71A.bssp"
#ERROR : Can't open dsspfile "1xxuA.bssp"
#ERROR : Can't open dsspfile "1st9A.bssp"
#ERROR : Can't open dsspfile "2h1aB.bssp"
#ERROR : Can't open dsspfile "2h1aA.bssp"
#ERROR : Can't open dsspfile "3drnB.bssp"
#ERROR : Can't open dsspfile "3drnA.bssp"
#ERROR : Can't open dsspfile "1su9B.bssp"
#ERROR : Can't open dsspfile "1su9A.bssp"
#ERROR : Can't open dsspfile "1st9B.bssp"
#ERROR : Can't open dsspfile "2h1bC.bssp"
#ERROR : Can't open dsspfile "2h1bA.bssp"
#ERROR : Can't open dsspfile "3c73B.bssp"
#ERROR : Can't open dsspfile "3c73A.bssp"
#ERROR : Can't open dsspfile "2h1gB.bssp"
#ERROR : Can't open dsspfile "2h1gA.bssp"
#ERROR : Can't open dsspfile "2h19B.bssp"
#ERROR : Can't open dsspfile "2h19A.bssp"
#ERROR : Can't open dsspfile "2f9sA.bssp"
#ERROR : Can't open dsspfile "2f9sB.bssp"
#ERROR : Can't open dsspfile "1xvwB.bssp"
#ERROR : Can't open dsspfile "1xvwA.bssp"

## Summary of PDB Search
:212
    1e-54  53%  1prxB  [c.47.1] HORF6
    4e-54  52%  1prxA  [c.47.1] HORF6
    5e-54  51%  2v2gD  [x.x.x] PEROXIREDOXIN 6
    5e-54  51%  2v2gB  [x.x.x] PEROXIREDOXIN 6
    5e-54  51%  2v2gA  [x.x.x] PEROXIREDOXIN 6
    1e-52  51%  2v41C  [x.x.x] PEROXIREDOXIN 6.
    7e-39  41%  1xccB  [c.47.1] 1-CYS PEROXIREDOXIN
    7e-39  41%  1xccA  [c.47.1] 1-CYS PEROXIREDOXIN
    6e-38  40%  1xccD  [c.47.1] 1-CYS PEROXIREDOXIN
    4e-29  37%  2e2gB  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-28  37%  2e2gC  [x.x.x] PROBABLE PEROXIREDOXIN
    4e-28  37%  2e2gA  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-27  41%  1x0rA  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-27  41%  1vgsE  [c.47.1] PEROXIREDOXIN
    2e-27  41%  1vgsD  [c.47.1] PEROXIREDOXIN
    2e-27  41%  1vgsA  [c.47.1] PEROXIREDOXIN
    2e-27  37%  2e2mC  [x.x.x] PROBABLE PEROXIREDOXIN
    4e-27  37%  2nvlB  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-26  37%  2nvlC  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-26  37%  2e2mH  [x.x.x] PROBABLE PEROXIREDOXIN
    3e-26  37%  2zctD  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctH  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctG  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctE  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctC  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctB  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2zctA  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2e2mE  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2e2mD  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-25  37%  2e2mA  [x.x.x] PROBABLE PEROXIREDOXIN
    5e-25  41%  2cv4E  [x.x.x] PEROXIREDOXIN
    5e-25  41%  2cv4D  [x.x.x] PEROXIREDOXIN
    5e-25  41%  2cv4A  [x.x.x] PEROXIREDOXIN
    9e-21  33%  1uulA  [c.47.1] TRYPAREDOXIN PEROXIDASE HOMOLOGUE
    9e-21  32%  2h01A  [x.x.x] 2-CYS PEROXIREDOXIN
    3e-20  30%  2riiB  [x.x.x] PEROXIREDOXIN-1
    3e-20  30%  2riiA  [x.x.x] PEROXIREDOXIN-1
    3e-20  32%  2fegA  [x.x.x] 2-CYS PEROXIREDOXIN
    8e-20  33%  1qmvA  [c.47.1] HUMAN THIOREDOXIN PEROXIDASE-B
    1e-19  31%  2z9sA  [x.x.x] PEROXIREDOXIN-1
    5e-19  31%  1zofB  [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE
    6e-19  29%  2i81B  [x.x.x] 2-CYS PEROXIREDOXIN
    6e-19  29%  2i81A  [x.x.x] 2-CYS PEROXIREDOXIN
    6e-19  29%  2h66I  [x.x.x] PV-PF14_0368
    1e-18  29%  3hy2B  [x.x.x] PEROXIREDOXIN-1
    1e-18  29%  3hy2A  [x.x.x] PEROXIREDOXIN-1
    7e-18  31%  1qq2A  [c.47.1] THIOREDOXIN PEROXIDASE 2
    9e-18  35%  2bmxB  [x.x.x] ALKYL HYDROPEROXIDASE C
    9e-18  35%  2bmxA  [x.x.x] ALKYL HYDROPEROXIDASE C
    1e-17  31%  1zofA  [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE
    2e-17  31%  2c0dB  [x.x.x] THIOREDOXIN PEROXIDASE 2
    8e-17  29%  2h66B  [x.x.x] PV-PF14_0368
    1e-16  28%  2pn8H  [x.x.x] PEROXIREDOXIN-4
    1e-16  28%  2pn8A  [x.x.x] PEROXIREDOXIN-4
    2e-16  29%  2h66F  [x.x.x] PV-PF14_0368
    2e-16  29%  2h66D  [x.x.x] PV-PF14_0368
    2e-16  29%  2h66C  [x.x.x] PV-PF14_0368
    2e-16  29%  2h66A  [x.x.x] PV-PF14_0368
    5e-16  30%  2h66J  [x.x.x] PV-PF14_0368
    5e-16  30%  2h66E  [x.x.x] PV-PF14_0368
    2e-15  29%  2i81D  [x.x.x] 2-CYS PEROXIREDOXIN
    4e-15  32%  1n8jA  [c.47.1] ALKYL HYDROPEROXIDE REDUCTASE C22 PROTEIN
    4e-15  31%  1e2yG  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-14  30%  2c0dA  [x.x.x] THIOREDOXIN PEROXIDASE 2
    5e-14  30%  1zyeA  [x.x.x] THIOREDOXIN-DEPENDENT PEROXIDE REDUCTASE
    5e-14  33%  1yepD  [c.47.1 (1kygA)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    5e-14  33%  1yepC  [c.47.1 (1kygC)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    5e-14  33%  1yepB  [c.47.1 (1kygB)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    5e-14  33%  1yepA  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    5e-14  33%  3empB  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    5e-14  33%  3empA  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    6e-14  33%  1yexD  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    6e-14  33%  1yexC  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    6e-14  33%  1yexB  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    6e-14  33%  1yexA  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf1C  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf1B  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf1A  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf0D  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf0C  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf0B  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    1e-13  33%  1yf0A  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
    3e-13  30%  1e2yB  [c.47.1] TRYPAREDOXIN PEROXIDASE
    4e-13  31%  1e2yC  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-12  31%  1e2yH  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-12  31%  1e2yE  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-12  31%  1e2yD  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-12  31%  1e2yA  [c.47.1] TRYPAREDOXIN PEROXIDASE
    3e-12  33%  1e2yF  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-11  28%  1we0A  [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE C
    2e-10  32%  2cx3B  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    2e-10  32%  2cx3A  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    3e-08  33%  3gknA  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    3e-08  33%  3gkmA  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    3e-07  33%  3gkkA  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    1e-06  33%  3c71A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-06  28%  1xxuA  [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
    4e-06  32%  1st9A  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-06  32%  2h1aB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-06  32%  2h1aA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-06  27%  3drnB  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    6e-06  27%  3drnA  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    8e-06  32%  1su9B  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    8e-06  32%  1su9A  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    8e-06  32%  1st9B  [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    8e-06  31%  2h1bC  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    8e-06  31%  2h1bA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-05  32%  3c73B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-05  32%  3c73A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-05  31%  2h1gB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    7e-05  31%  2h1gA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    9e-05  31%  2h19B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    9e-05  31%  2h19A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-04  30%  2f9sA  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    3e-04  30%  2f9sB  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    4e-04  27%  1xvwB  [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
    4e-04  27%  1xvwA  [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
1prxB           --LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPV-TTELGRAAKLAPEFAKRNVKLIALS
1prxA           --LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPV-TTELGRAAKLAPEFAKRNVKLIALS
2v2gD           ----LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALS
2v2gB           ----LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALS
2v2gA           ----LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALS
2v41C           ----LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALS
1xccB           ---HLGATFPNFTAKASDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKLNCKLIGFS
1xccA           ---HLGATFPNFTAKASDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKLNCKLIGFS
1xccD           ----LGATFPNFTAKASDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKLNCKLIGFS
2e2gB           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2e2gC           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2e2gA           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
1x0rA           ------------------------------WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
1vgsE           ------------------------------WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
1vgsD           ------------------------------WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
1vgsA           ------------------------------WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2e2mC           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2nvlB           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2nvlC           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2e2mH           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctD           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctH           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctG           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctE           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctC           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctB           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2zctA           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2e2mE           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2e2mD           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2e2mA           ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2cv4E           ------------------------------WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2cv4D           ------------------------------WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
2cv4A           ------------------------------WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS
1uulA           --------APDFNETATFKKVALTSYKGK-WLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACS
2h01A           --------APSFKAEATFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCS
2riiB           ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGAS
2riiA           ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGAS
2fegA           --------APSFKAEATFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCS
1qmvA           ----IGKPAPDFKATAVVDEVKLSDYKGK-YVVLFFYPLDFTFV-PTEIIAFSNRAEDFRKLGCEVLGVS
2z9sA           ----IGHPAPSFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVSPTEIIAFSDRAEEFKKLNCQVIGAS
1zofB           -------LAPDFKAPAVLGDEHFEKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVS
2i81B           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2i81A           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66I           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
3hy2B           ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVDPTEIIAFSDRAEEFKKLNSQVIGAS
3hy2A           ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVDPTEIIAFSDRAEEFKKLNSQVIGAS
1qq2A           ----IGHPAPSFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGAS
2bmxB           ------------------------------WRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVS
2bmxA           ------------------------------WRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVS
1zofA           -------LAPDFKAPAVLGDEHFEKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVS
2c0dB           -------------------------FIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGIS
2h66B           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2pn8H           ------------------------------YLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACS
2pn8A           ------------------------------YLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACS
2h66F           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66D           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66C           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66A           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66J           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2h66E           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
2i81D           ---YVGKEAPFFKAEAVFGDNSFGEFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCS
1n8jA           ------------------------------WSVFFFYPADFTFVSPTELGDVADHYEELQKLGVDVYSVS
1e2yG           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
2c0dA           -------------------------FIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGIS
1zyeA           ------------------------------YLVLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVS
1yepD           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yepC           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yepB           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yepA           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
3empB           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
3empA           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yexD           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yexC           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yexB           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yexA           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf1C           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf1B           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf1A           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf0D           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf0C           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf0B           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1yf0A           ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
1e2yB           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yC           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yH           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yE           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yD           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yA           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yF           ------------------------------YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1we0A           ------------------------------WSIVVFYPADFSFVCPTELEDVQKEYAELKKLGVEVYSVS
2cx3B           --VELGEKAPDFTPNQDFEPVNLYEVLKRGRAVLIFFPAAFSPVCTKELCTFRDKA-QLEKANAEVLAIS
2cx3A           --VELGEKAPDFTPNQDFEPVNLYEVLKRGRAVLIFFPAAFSPVCTKELCTFRDKA-QLEKANAEVLAIS
3gknA           ------------------------------WLVIYFYPKDSTPGATTEGLDFNALLPEFDKAGAKILGVS
3gkmA           ------------------------------WLVIYFYPKDSTPGSTTEGLDFNALLPEFDKAGAKILGVS
3gkkA           ------------------------------WLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVS
3c71A           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCPHCKKEFPYMANQYKHFKSQGVEIVAVN
1xxuA           --LNVGATAPDFTRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAIS
1st9A           -----GSDAPNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
2h1aB           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWAEPCKKEFPYMANQYKHFKSQGVEIVAVN
2h1aA           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWAEPCKKEFPYMANQYKHFKSQGVEIVAVN
3drnB           ----VGDKAPLFEGIADNGEISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKXXXXXXXXXX
3drnA           ----VGDKAPLFEGIADNGEISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKXXXXXXXXXX
1su9B           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
1su9A           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
1st9B           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
2h1bC           -----GSDAPNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKQFPYMANQYKHFKSQGVEIVAVN
2h1bA           -----GSDAPNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKQFPYMANQYKHFKSQGVEIVAVN
3c73B           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEHCKKEFPYMANQYKHFKSQGVEIVAVN
3c73A           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEHCKKEFPYMANQYKHFKSQGVEIVAVN
2h1gB           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWAEPAKKEFPYMANQYKHFKSQGVEIVAVN
2h1gA           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWAEPAKKEFPYMANQYKHFKSQGVEIVAVN
2h19B           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIVAVN
2h19A           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIVAVN
2f9sA           -----GSDAPNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEF-PYANQYKHFKSQGVEIVAVN
2f9sB           --------APNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEF-PYANQYKHFKSQGVEIVAVN
1xvwB           --LNVGATAPDFTRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGI-QGELDQLRDHLPEFENDDSAALAIS
1xvwA           --LNVGATAPDFTRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGI-QGELDQLRDHLPEFENDDSAALAIS


                         .         .         *         .         .         .         .:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
1prxB           IDSVEDHLAWSKDINEEPTEKLPFPIIDDRNRELAILLGMLDP-AEMPVTARVVFVFGPDKKLKLSILYP
1prxA           IDSVEDHLAWSKDINEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEVTARVVFVFGPDKKLKLSILYP
2v2gD           CDNVADHKEWSEDVKCLSGVKMPYPIIADETRELAVKLGMVDPSTGMPLTCRAVFIIGPDKKLKLSILYP
2v2gB           CDNVADHKEWSEDVKCLSGVKMPYPIIADETRELAVKLGMVDPSTGMPLTCRAVFIIGPDKKLKLSILYP
2v2gA           CDNVADHKEWSEDVKCLSGVKMPYPIIADETRELAVKLGMVDPSTGMPLTCRAVFIIGPDKKLKLSILYP
2v41C           CDNVADHKEWSEDVKCLSGVKMPYPIIADETRELAVKLGMVDPSTGMPLTCRAVFIIGPDKKLKLSILYP
1xccB           CNSKESHDKWIEDIKYYGKLNKEIPIVCDESRELANKLKIMDEQEKDILTCRCLFFISPEKKIKATVLYP
1xccA           CNSKESHDKWIEDIKYYGKLNKEIPIVCDESRELANKLKIMDEQEKDILTCRCLFFISPEKKIKATVLYP
1xccD           CNSKESHDKWIEDIKYYGKLNKEIPIVCDESRELANKLKIMDEQEKDILTCRCLFFISPEKKIKATVLYP
2e2gB           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH----ATHTVRGVFIVDARGVIRTMLYYP
2e2gC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL----SATHTVRGVFIVDARGVIRTMLYYP
2e2gA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVAR-----RLGLLATHTVRGVFIVDARGVIRTMLYYP
1x0rA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
1vgsE           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
1vgsD           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
1vgsA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
2e2mC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTMLYYP
2nvlB           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH---AESHTVRGVFIVDARGVIRTMLYYP
2nvlC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLE---SATHTVRGVFIVDARGVIRTMLYYP
2e2mH           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL--AESATHTVRGVFIVDARGVIRTMLYYP
2zctD           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL----SATHTVRGVFIVDARGVIRTMLYYP
2zctH           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2zctG           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2zctE           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2zctC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2zctB           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2zctA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2e2mE           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2e2mD           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2e2mA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVRGVFIVDARGVIRTMLYYP
2cv4E           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
2cv4D           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
2cv4A           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YY
1uulA           MDSEYSHLAWTSIERKRGGLQMNIPILADKTKCIMKSYGVLKE--EDGVAYRGLFIIDPKQNLRQITVND
2h01A           VDSKFTHLAWKKTPLSQGGINIKHTLISDISKSIARSYDVLF---NESVALRAFVLIDKQGVVQHLLVNN
2riiB           VDSHFEHLAWVNTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
2riiA           VDSHFEHLAWVNTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
2fegA           VDSKFTHLAWKKTPLSQGGINIKHTLISDISKSIARSYDVLF---NESVALRAFVLIDKQGVVQHLLVNN
1qmvA           VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRRLSEDYGVLK--TDEGIAYRGLFIIDGKGVLRQITVND
2z9sA           VDSHFCHLAWINTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
1zofB           IDSEQVHFAWKNTPVEKGGIQVSFPMVADITKSISRDYDVLF---EEAIALRGAFLIDKNMKVRHAVIND
2i81B           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2i81A           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66I           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
3hy2B           VDSHFEHLEWVNTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
3hy2A           VDSHFEHLEWVNTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
1qq2A           VDSHFSHLAWINTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
2bmxB           IDSEFAHFQWRAQHNDLK--TLPFP-LSDIKRELSQAAGVLN---ADGVADRVTFIVDPNNEIQFVSATA
2bmxA           IDSEFAHFQWRAQHNDLK--TLPFP-LSDIKRELSQAAGVLN---ADGVADRVTFIVDPNNEIQFVSATA
1zofA           IDSEQVHFAWKNTPVEKGGIQVSFPMVADITKSISRDYDVLF---EEAIALRGAFLIDKNMKVRHAVIND
2c0dB           VDSVYSHLAWKNMPIEKGGINVEFTLVSDINKDISKNYNVLY---DNSFALRGLFIIDKNGCVRHQTVND
2h66B           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2pn8H           VDSQFTHLAWINTPRRQGGLPIRIPLLSDLTHQISKDYGVYLEDSGHTL--RGLFIIDDKGILRQITLND
2pn8A           VDSQFTHLAWINTPRRQGGLPIRIPLLSDLTHQISKDYGVYLEDSGHTL--RGLFIIDDKGILRQITLND
2h66F           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66D           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66C           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66A           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66J           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2h66E           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLVNN
2i81D           VDSKYTHLAWKKTPLAKGGINIKHTLLSDITKSISKDYNVLF---DDSVSLRAFVLIDMNGIVQHLLV-N
1n8jA           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1e2yG           CDSEYSHLQWTSVDRKKGGLGPAIPL-ADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
2c0dA           VDSVYSHLAWKNMPIEKGGINVEFTLVSDINKDISKNYNVLY---DNSFALRGLFIIDKNGCVRHQTVND
1zyeA           VDSHFSHLAWINTPRKNGGLHMNIALLSDLTKQISRDYGVLLEGPG--LALRGLFIIDPNGVIKHLSVND
1yepD           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yepC           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yepB           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yepA           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
3empB           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
3empA           TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yexD           TDTHFDHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yexC           TDTHFDHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yexB           TDTHFDHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yexA           TDTHFDHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf1C           TDTHFVHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf1B           TDTHFVHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf1A           TDTHFVHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf0D           TDTHFIHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf0C           TDTHFIHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf0B           TDTHFIHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1yf0A           TDTHFIHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
1e2yB           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yC           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yH           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yE           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yD           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yA           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1e2yF           CDSEYSHLQWTSVDRKKGGLGPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIIND
1we0A           TDTHFVHKAWHE--NSPAVGSIEYIMIGDPSQTISRQFDVLNEETG--LADRGTFIIDPDGVIQAIEINA
2cx3B           VDSPWCLKKF-KDEN-----RLAFNLLSDYNREVIKLYNVYHEDLKGKVAKRAVFIVKPDGTVAKWVTDN
2cx3A           VDSPWCLKKF-KDEN-----RLAFNLLSDYNREVIKLYNVYHEDLKGKVAKRAVFIVKPDGTVAKWVTDN
3gknA           RDSVKSHDNFCA----KQG--FAFPLVSDGDEALCRAFDVIKEGKQVLGIERSTFLLSPEGQV-------
3gkmA           RDSVKSH----DNFSAKQG--FAFPLVSDGDEALCRAFDVIKEGKQVLGIERSTFLLSPEGQV-------
3gkkA           RDSV-------KNFCAKQG--FAFPLVSDGDEALCRAFDVIKEGKQVLGIERSTFLLSPEGQV-------
3c71A           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
1xxuA           VGPPPTHKIWATQSGFT------FPLLSDPHGAVSQAYGVFNEQAG--IANRGTFVVDRSGIIRFAEMKQ
1st9A           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1aB           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1aA           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
3drnB           XXXXNSHKRF------KEKYKLPFILVSDPDKKIRELY-----GAKGFIPARITFVIDKKGIIRHIYNSQ
3drnA           XXXXNSHKRF------KEKYKLPFILVSDPDKKIRELY-----GAKGFIPARITFVIDKKGIIRHIYNSQ
1su9B           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
1su9A           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
1st9B           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1bC           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1bA           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
3c73B           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
3c73A           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1gB           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h1gA           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h19B           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2h19A           VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2f9sA           VGESKIA------VHNFKSYGVNFPVVLDTDRQVLDAYDV------------------------------
2f9sB           VGESKIA------VHNFKSYGVNFPVVLDTDRQVLDAYDV------------------------------
1xvwB           VGPPPTHKIWATQSGFT------FPLLSDPHGAVSQAYGVFNEQAG--IANRGTFVVDRSGIIRFAEMKQ
1xvwA           VGPPPTHKIWATQSGFT------FPLLSDPHGAVSQAYGVFNEQAG--IANRGTFVVDRSGIIRFAEMKQ


                         +         .         .         .         .         *         .:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
1prxB           ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVKELKKYLRYTPQP
1prxA           ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVKELKKYLRYTPQP
2v2gD           ATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEA-KTLFPKAVPSGKGYLRYTPQP
2v2gB           ATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEA-KTLFPKAVPSGKGYLRYTPQP
2v2gA           ATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEA-KTLFPKAVPSGKGYLRYTPQP
2v41C           ATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEA-KTLFPKAVPSGKGYLRYTP--
1xccB           ATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISK--------------------
1xccA           ATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISK--------------------
1xccD           ATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISK--------------------
2e2gB           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2gC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2gA           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
1x0rA           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
1vgsE           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
1vgsD           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
1vgsA           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
2e2mC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2nvlB           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2nvlC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2mH           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctD           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctH           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctG           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctE           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctB           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2zctA           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2mE           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2mD           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2e2mA           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
2cv4E           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
2cv4D           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
2cv4A           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNGEGLIVPPPTTEDQ-----------------------
1uulA           LPVGRDVDEALRLVKAFQFVEKHGEVCPANWKPGDKTM----KPDPEKSKEYF-----------------
2h01A           LALGRSVDEILRLIDALQHHEKYGDVCPANWQKG------------------------------------
2riiB           LPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI--------------------------------
2riiA           LPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI--------------------------------
2fegA           LALGRSVDEILRLIDALQHHEKYGDVCPANWQ--------------------------------------
1qmvA           LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
2z9sA           LPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVNKSK------------------
1zofB           LPLGRNADEMLRMVDALLHFEEHGEVCPAGWR--------------------------------------
2i81B           LAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG------------------------------------
2i81A           LAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG------------------------------------
2h66I           LAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG------------------------------------
3hy2B           LPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI--------------------------------
3hy2A           LPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI--------------------------------
1qq2A           LPVGRSVDEILRLVQAFQFTDKHGEVCP------------------------------------------
2bmxB           GSVGRNVDEVLRVLDALQ----------------------------------------------------
2bmxA           GSVGRNVDEVLRVLDALQ----------------------------------------------------
1zofA           LPLGRNADEMLRMVDALLHFEEHGEVCP------------------------------------------
2c0dB           LPIGRNVQEVLRTIDSIIHVDTSGEVCPINWKKG------------------------------------
2h66B           LAIGRSVDEILRIIDAIQHHEKYGDVCP------------------------------------------
2pn8H           LPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETII-------------------------------
2pn8A           LPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETII-------------------------------
2h66F           LAIGRSVDEILRIIDAIQHHEKY-----------------------------------------------
2h66D           LAIGRSVDEILRIIDAIQHHEKY-----------------------------------------------
2h66C           LAIGRSVDEILRIIDAIQHHEKY-----------------------------------------------
2h66A           LAIGRSVDEILRIIDAIQHHEKY-----------------------------------------------
2h66J           LAIGRSVDEILRIIDAIQ----------------------------------------------------
2h66E           LAIGRSVDEILRIIDAIQ----------------------------------------------------
2i81D           NAIGRSVDEILRIIDAIQHHEKY-----------------------------------------------
1n8jA           EGIGRDASDLLRKIKAAQVAAHPGEVCPAKWKEG-EATLAPSL---------------------------
1e2yG           P-IGRNVEEVIRLVEALQFVEEHGEVCPANWK--------------------------------------
2c0dA           LPIGRNVQEVLRTIDSIIHVDTSGEVCP------------------------------------------
1zyeA           LPVGRSVEETLRLVKAFQFVE-------------------------------------------------
1yepD           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yepC           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yepB           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yepA           EGIGRDASDLLRKIKAAQ----------------------------------------------------
3empB           EGIGRDASDLLRKIKAAQ----------------------------------------------------
3empA           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yexD           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yexC           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yexB           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yexA           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf1C           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf1B           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf1A           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf0D           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf0C           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf0B           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1yf0A           EGIGRDASDLLRKIKAAQ----------------------------------------------------
1e2yB           P-IGRNVEEVIRLVEALQFVEEHGEVCPAN----------------------------------------
1e2yC           P-IGRNVEEVIRLVEALQFVEEHGEVCP------------------------------------------
1e2yH           P-IGRNVEEVIRLVEALQFVEEH-----------------------------------------------
1e2yE           P-IGRNVEEVIRLVEALQFVEEH-----------------------------------------------
1e2yD           P-IGRNVEEVIRLVEALQFVEEH-----------------------------------------------
1e2yA           P-IGRNVEEVIRLVEALQFVEEH-----------------------------------------------
1e2yF           P-IGRNVEEVIRLVEALQ----------------------------------------------------
1we0A           DGIGRDASTLINKVKAAQ----------------------------------------------------
2cx3B           PLNEPDYDEVVR----------------------------------------------------------
2cx3A           PLNEPDYDEVVR----------------------------------------------------------
3gknA           ----------------------------------------------------------------------
3gkmA           ----------------------------------------------------------------------
3gkkA           ----------------------------------------------------------------------
3c71A           ----------------------------------------------------------------------
1xxuA           PGEVRD----------------------------------------------------------------
1st9A           ----------------------------------------------------------------------
2h1aB           ----------------------------------------------------------------------
2h1aA           ----------------------------------------------------------------------
3drnB           MNPANHVNEALKALKQIK----------------------------------------------------
3drnA           MNPANHVNEALKALKQIK----------------------------------------------------
1su9B           ----------------------------------------------------------------------
1su9A           ----------------------------------------------------------------------
1st9B           ----------------------------------------------------------------------
2h1bC           ----------------------------------------------------------------------
2h1bA           ----------------------------------------------------------------------
3c73B           ----------------------------------------------------------------------
3c73A           ----------------------------------------------------------------------
2h1gB           ----------------------------------------------------------------------
2h1gA           ----------------------------------------------------------------------
2h19B           ----------------------------------------------------------------------
2h19A           ----------------------------------------------------------------------
2f9sA           ----------------------------------------------------------------------
2f9sB           ----------------------------------------------------------------------
1xvwB           PGEVRD----------------------------------------------------------------
1xvwA           PGEVRD----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xx
1prxB           --
1prxA           --
2v2gD           --
2v2gB           --
2v2gA           --
2v41C           --
1xccB           --
1xccA           --
1xccD           --
2e2gB           --
2e2gC           --
2e2gA           --
1x0rA           --
1vgsE           --
1vgsD           --
1vgsA           --
2e2mC           --
2nvlB           --
2nvlC           --
2e2mH           --
2zctD           --
2zctH           --
2zctG           --
2zctE           --
2zctC           --
2zctB           --
2zctA           --
2e2mE           --
2e2mD           --
2e2mA           --
2cv4E           --
2cv4D           --
2cv4A           --
1uulA           --
2h01A           --
2riiB           --
2riiA           --
2fegA           --
1qmvA           --
2z9sA           --
1zofB           --
2i81B           --
2i81A           --
2h66I           --
3hy2B           --
3hy2A           --
1qq2A           --
2bmxB           --
2bmxA           --
1zofA           --
2c0dB           --
2h66B           --
2pn8H           --
2pn8A           --
2h66F           --
2h66D           --
2h66C           --
2h66A           --
2h66J           --
2h66E           --
2i81D           --
1n8jA           --
1e2yG           --
2c0dA           --
1zyeA           --
1yepD           --
1yepC           --
1yepB           --
1yepA           --
3empB           --
3empA           --
1yexD           --
1yexC           --
1yexB           --
1yexA           --
1yf1C           --
1yf1B           --
1yf1A           --
1yf0D           --
1yf0C           --
1yf0B           --
1yf0A           --
1e2yB           --
1e2yC           --
1e2yH           --
1e2yE           --
1e2yD           --
1e2yA           --
1e2yF           --
1we0A           --
2cx3B           --
2cx3A           --
3gknA           --
3gkmA           --
3gkkA           --
3c71A           --
1xxuA           --
1st9A           --
2h1aB           --
2h1aA           --
3drnB           --
3drnA           --
1su9B           --
1su9A           --
1st9B           --
2h1bC           --
2h1bA           --
3c73B           --
3c73A           --
2h1gB           --
2h1gA           --
2h19B           --
2h19A           --
2f9sA           --
2f9sB           --
1xvwB           --
1xvwA           --