[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA57898.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mjhB.bssp"
#ERROR : Can't open dsspfile "1mjhA.bssp"
#ERROR : Can't open dsspfile "1tq8E.bssp"
#ERROR : Can't open dsspfile "1tq8A.bssp"
#ERROR : Can't open dsspfile "2i9zA.bssp"
#ERROR : Can't open dsspfile "3cisH.bssp"
#ERROR : Can't open dsspfile "3cisG.bssp"
#ERROR : Can't open dsspfile "3cisF.bssp"
#ERROR : Can't open dsspfile "3cisE.bssp"
#ERROR : Can't open dsspfile "3cisC.bssp"
#ERROR : Can't open dsspfile "3cisB.bssp"
#ERROR : Can't open dsspfile "3cisA.bssp"

## Summary of PDB Search
:152
    6e-09  30%  1mjhB  [c.26.2] PROTEIN (ATP-BINDING DOMAIN OF PROTEIN MJ0577)
    7e-09  30%  1mjhA  [c.26.2] PROTEIN (ATP-BINDING DOMAIN OF PROTEIN MJ0577)
    2e-05  31%  1tq8E  [c.26.2] HYPOTHETICAL PROTEIN RV1636
    2e-05  31%  1tq8A  [c.26.2] HYPOTHETICAL PROTEIN RV1636
    3e-04  38%  2i9zA  [x.x.x] PUTATIVE SEPTATION PROTEIN SPOVG
    4e-04  31%  3cisH  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisG  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisF  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisE  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisC  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisB  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  31%  3cisA  [x.x.x] UNCHARACTERIZED PROTEIN
:152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYVFPTRATSDFDFLSITHPEEEDNEQL
1mjhB           ------------------------------------------------------DEREIKSVEEFENELK
1mjhA           --------------------------------------------------------------EEFENELK
1tq8E           ----------------------------------------------------------------------
1tq8A           ----------------------------------------------------------------------
2i9zA           ------------------------------------------LFVAPSKRTPDGEFRDIAHPINSDRQEI
3cisH           ----------------------------------------------------------------------
3cisG           ----------------------------------------------------------------------
3cisF           ----------------------------------------------------------------------
3cisE           ----------------------------------------------------------------------
3cisC           ----------------------------------------------------------------------
3cisB           ----------------------------------------------------------------------
3cisA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVIGRRGLSRFEALLLGSVSEKV
1mjhB           NKEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENV
1mjhA           NKEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENV
1tq8E           --------------------KNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANV
1tq8A           --------------------KNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANV
2i9zA           --QDAVKVYDETDEVI------------------------------------------------------
3cisH           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisG           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisF           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisE           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisC           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisB           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV
3cisA           -----------AERLAGWQERAITRVVVRDQPARQLVQRSEEAQ--LVVVGSRGRGGYAGMLVGSVGETV


                         +         .         .         .         .         *         .:210
query           VRHASGPVTIIH
1mjhB           IKKSNKPVLVV-
1mjhA           IKKSNKPVLVV-
1tq8E           SRRAKVDVLIVH
1tq8A           SRRAKVDVLIVH
2i9zA           ------------
3cisH           AQLARTPVIV--
3cisG           AQLARTPVIV--
3cisF           AQLARTPVIV--
3cisE           AQLARTPVIV--
3cisC           AQLARTPVIV--
3cisB           AQLARTPVIV--
3cisA           AQLARTPVIV--