[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58132.1

[Show Plain Result]

#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3hjnA.bssp"
#ERROR : Can't open dsspfile "3hjnB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2z0hA.bssp"
#ERROR : Can't open dsspfile "2pbrA.bssp"
#ERROR : Can't open dsspfile "2z0hB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1nn5A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3tmkE.bssp"
#ERROR : Can't open dsspfile "3tmkD.bssp"
#ERROR : Can't open dsspfile "3tmkA.bssp"
#ERROR : Can't open dsspfile "3tmkC.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "2plrA.bssp"
#ERROR : Can't open dsspfile "2plrB.bssp"
#ERROR : Can't open dsspfile "1n5kB.bssp"

## Summary of PDB Search
:206
    2e-37  44%  4tmkA  [c.37.1] PROTEIN (THYMIDYLATE KINASE)
    5e-29  34%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    1e-27  40%  3hjnA  [x.x.x] THYMIDYLATE KINASE
    1e-27  41%  3hjnB  [x.x.x] THYMIDYLATE KINASE
    8e-27  37%  2cckA  [x.x.x] THYMIDYLATE KINASE
    8e-27  34%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-26  36%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    1e-26  35%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    3e-26  37%  2cckB  [x.x.x] THYMIDYLATE KINASE
    4e-25  39%  2z0hA  [x.x.x] THYMIDYLATE KINASE
    1e-19  35%  2pbrA  [x.x.x] THYMIDYLATE KINASE
    1e-19  46%  2z0hB  [x.x.x] THYMIDYLATE KINASE
    4e-07  29%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    5e-07  27%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    5e-07  27%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    9e-07  29%  1nn5A  [c.37.1] SIMILAR TO DEOXYTHYMIDYLATE KINASE (THYMIDYLATE
    9e-07  27%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    2e-06  27%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-06  27%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-06  27%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    8e-06  28%  3tmkE  [c.37.1] THYMIDYLATE KINASE
    8e-06  28%  3tmkD  [c.37.1] THYMIDYLATE KINASE
    8e-06  28%  3tmkA  [c.37.1] THYMIDYLATE KINASE
    1e-05  30%  3tmkC  [c.37.1] THYMIDYLATE KINASE
    1e-05  30%  1tmkA  [c.37.1] THYMIDYLATE KINASE
    5e-05  27%  2plrA  [x.x.x] PROBABLE THYMIDYLATE KINASE
    3e-04  28%  2plrB  [x.x.x] PROBABLE THYMIDYLATE KINASE
    6e-04  24%  1n5kB  [c.37.1] THYMIDYLATE KINASE
:206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
4tmkA           VIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTQLAEKLRSLLLDIKSVGDEVITEVLMFYAARVQ
2ccgA           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVLEGN--DMDIRTEAMLFAASRRE
3hjnA           --EGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILLE---EEVTPKAELFLFLASRNL
3hjnB           --EGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILLE---EEVTPKAELFLFLASRNL
2cckA           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVL----EDMDIRTEAMLFAASRRE
2ccgB           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVLEGN--DMDIRTEAMLFAASRRE
2ccjA           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVLEGN--DMDIRTEAMLFAASRRE
2ccjB           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVLEGN--DMDIRTEAMLFAASRRE
2cckB           --EGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGGVPTGEEIRKIVL----EGMDIRTEAMLFAASRRE
2z0hA           --EGIDGSGKSTQIQLLAQYLEKRGK-VILKREPGGTETGEKIRKILLE---EEVTPKAELFLFLASR--
2pbrA           --EGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGEVXXXXXXXXXXXXXXXXXXXX---ASRSK
2z0hB           --EGIDGSGKSTQIQLLAQYL---EKKVILKREPGGTETGEKIRKILLE---EEVTPKAELFLFLASR--
1e9fA           VLEGVDGAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e9dA           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e9cA           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1nn5A           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e2gA           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e98A           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e2fA           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
1e2dA           VLEGVDRAGKSTQRKLVEALCAAGHRAELLRFPERSTEIGK-----LLSSYLQKKSEDHSVHLLFSANRW
3tmkE           LIEGLDRTGKTTQCNILYKKLQPNCK--LLKFPERSTRIGGLINEYLTDDSFQ--LSDQAIHLLFSANRW
3tmkD           LIEGLDRTGKTTQCNILYKKLQPNCK--LLKFPERSTRIGGLINEYLTDDSFQ--LSDQAIHLLFSANRW
3tmkA           LIEGLDRTGKTTQCNILYKKLQPNCK--LLKFPERSTRIGGLINEYLTDDSFQ--LSDQAIHLLFSANRW
3tmkC           LIEGLDRTGKTTQCNILYKKLQPNCK--LLKFPERSTRIGGLINEYLTDDSFQ--LSDQAIHLLFSANRW
1tmkA           LIEGLDRTGKTTQCNILYKKLQPNCK--LLKFPERSTRIGGLINEYLTDDSFQ--LSDQAIHLLFSANRW
2plrA           --EGIDGSGKSSQATLLKDWIE-LKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYE
2plrB           --EGIDGSGKSSQATLLKDWIELKRDVYLTESDWIHDIIKEAKKKDLLTPLTFSLIHATD----FSDRYE
1n5kB           -IEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRA


                         .         .         *         .         .         .         .:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
4tmkA           LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRA
2ccgA           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
3hjnA           LVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKRK
3hjnB           LVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKR-
2cckA           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
2ccgB           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
2ccjA           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
2ccjB           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
2cckB           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERI
2z0hA           ---NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKRK
2pbrA           LIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFATRGVKPDITLLLDIPVDIALR--
2z0hB           ---NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDV-------
1e9fA           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLF----LQLQLADA
1e9dA           EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
1e9cA           EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
1nn5A           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLF----LQLQLADA
1e2gA           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
1e98A           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
1e2fA           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
1e2dA           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRG
3tmkE           EIVDKIKKDLLEGKNIVMDRYVYSGVAYSANGMDL---------DW---CLQPDVGLLKDLTLFLSTQDV
3tmkD           EIVDKIKKDLLEGKNIVMDRYVYSGVAYSANGMDL---------DW---CLQPDVGLLKDLTLFLSTQDV
3tmkA           EIVDKIKKDLLEGKNIVMDRYVYSGVAYSANGMDL---------DW---CLQPDVGLLKDLTLFLSTQDV
3tmkC           EIVDKIKKDLLEGKNIVMDRYVYSGVAYSANGMDL---------DW---CLQPDVGLLKDLTLFLSTQ--
1tmkA           EIVDKIKKDLLEGKNIVMDRYVYSGVAYSANGMDL---------DW---CLQPDVGLLKDLTLFLSTQFG
2plrA           ---RYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKLYSFA---IKPDITFYIRVSPDIALER-
2plrB           ---RYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKLYSFA---IKPDITFYIRVSPDIALER-
1n5kB           GAVHTIQGLCRGYDVVILDRYVASNAAYSAA--RLHENAAGKAAAWVLGLPKPDWQVLLAVSAELAGERS


                         +         .         .         .         .         *         .:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEExxxx
4tmkA           RAR-GELDRIEQESFDFFNRTRARYLELAAQ-DKSIHTIDATQPLEAVMDAIRTTVTHWVKE----
2ccgA           IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE-----
3hjnA           -------NRF--EKREFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDVVREV----------
3hjnB           -------NRF--EKREFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDV--------------
2cckA           IKN----SRLDQEDLKFHEKVIEGYQEIIR-----FKSVNADQPLENVVEDTYQTIIKYLEK----
2ccgB           IK-----NSLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK----
2ccjA           IKNSNRLD---QEDLKFHEKVIEGYQEIIHR----FKSVNADQPLENVVEDTYQTIIKYLEK----
2ccjB           IKN----NRLDQEDLKFHEKVIEGYQEIIQR----FKSVNADQPLENVVEDTYQTIIKYLEK----
2cckB           IK-----NRLDQEDLKFHEKVIEGYQEIIR-----FKSVNADQPLENVVEDTYQTIIKYLEK----
2z0hA           -------NRF--EKREFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDVVREV----------
2pbrA           --RLKEKNRFENK--EFLEKVRKGFLELAKE-EENVVVIDAS------------------------
2z0hB           ------------------------------------------------------------------
1e9fA           AKR--------YENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1e9dA           A--------FGHERYEFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1e9cA           A--------FGHERYEFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1nn5A           AKR----ERYENGA--FQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1e2gA           -------ERYENGA--FQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1e98A           A--------FGHERYEFQERALRCFHQLMKDTTLNWKMVDASKRIEAVHEEIR-------------
1e2fA           A--------FGHERYEFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
1e2dA           A--------FGHERYEFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-------------
3tmkE           DNNAEKSGFGDEETVKFQEKVKQTFMKLLDK---EIRKGDESITIVDVNKGIQEV-----------
3tmkD           DNNAEKSGFGDEETVKFQEKVKQTFMKLLDK---EIRKGDESITIVDVNKGIQEV-----------
3tmkA           DNNAEKSGFGDEETVKFQEKVKQTFMKLLDK---EIRKGDESITIVDVNKGIQEV-----------
3tmkC           -------DDERYETVKFQEKVKQTFMKLLDK---EIRKGDESITIVDVNKGIQEV-----------
1tmkA           DER--------YETVKFQEKVKQTFMKLLDK---EIRKGDESITIVDVNKGIQEV-----------
2plrA           ------------------------------------------------------------------
2plrB           ------------------------------------------------------------------
1n5kB           RGRAQRADNYERD-AELQQRTGAVYAELA-------------------------------------