[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zwrB.bssp"
#ERROR : Can't open dsspfile "2zwrA.bssp"
#ERROR : Can't open dsspfile "2gcuB.bssp"
#ERROR : Can't open dsspfile "2gcuA.bssp"
#ERROR : Can't open dsspfile "1xm8A.bssp"
#ERROR : Can't open dsspfile "2p18A.bssp"
#ERROR : Can't open dsspfile "2p1eA.bssp"
#ERROR : Can't open dsspfile "2gmnA.bssp"
#ERROR : Can't open dsspfile "2qedA.bssp"
#ERROR : Can't open dsspfile "1smlA.bssp"
#ERROR : Can't open dsspfile "2qjsA.bssp"
#ERROR : Can't open dsspfile "2qinC.bssp"
#ERROR : Can't open dsspfile "2qinB.bssp"
#ERROR : Can't open dsspfile "2qinA.bssp"
#ERROR : Can't open dsspfile "1l9yA.bssp"
#ERROR : Can't open dsspfile "1jt1A.bssp"
#ERROR : Can't open dsspfile "2zo4A.bssp"
#ERROR : Can't open dsspfile "1p9eA.bssp"
#ERROR : Can't open dsspfile "2q0jB.bssp"
#ERROR : Can't open dsspfile "2q0jA.bssp"
#ERROR : Can't open dsspfile "2q0iA.bssp"
#ERROR : Can't open dsspfile "3dh8A.bssp"
#ERROR : Can't open dsspfile "2p4zB.bssp"
#ERROR : Can't open dsspfile "2p4zA.bssp"

## Summary of PDB Search
:212
    6e-31  46%  2zwrB  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    6e-31  46%  2zwrA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    6e-17  37%  2gcuB  [x.x.x] PUTATIVE HYDROXYACYLGLUTATHIONE HYDROLASE 3
    6e-17  37%  2gcuA  [x.x.x] PUTATIVE HYDROXYACYLGLUTATHIONE HYDROLASE 3
    7e-13  31%  1xm8A  [d.157.1] GLYOXALASE II
    1e-11  40%  2p18A  [x.x.x] GLYOXALASE II
    1e-10  42%  2p1eA  [x.x.x] GLYOXALASE II
    4e-10  33%  2gmnA  [x.x.x] METALLO-BETA-LACTAMASE
    1e-09  33%  2qedA  [x.x.x] HYDROXYACYLGLUTATHIONE HYDROLASE
    3e-07  36%  1smlA  [d.157.1] PROTEIN (PENICILLINASE)
    1e-06  35%  2qjsA  [x.x.x] METALLO-BETA-LACTAMASE L1
    3e-06  35%  2qinC  [x.x.x] METALLO-BETA-LACTAMASE L1
    3e-06  35%  2qinB  [x.x.x] METALLO-BETA-LACTAMASE L1
    3e-06  35%  2qinA  [x.x.x] METALLO-BETA-LACTAMASE L1
    3e-05  32%  1l9yA  [d.157.1] FEZ-1 B-LACTAMASE
    3e-05  32%  1jt1A  [d.157.1] FEZ-1, CLASS B3 METALLO-BETA-LACTAMASE
    5e-05  31%  2zo4A  [x.x.x] METALLO-BETA-LACTAMASE FAMILY PROTEIN
    7e-05  32%  1p9eA  [d.157.1] METHYL PARATHION HYDROLASE
    2e-04  33%  2q0jB  [x.x.x] QUINOLONE SIGNAL RESPONSE PROTEIN
    2e-04  33%  2q0jA  [x.x.x] QUINOLONE SIGNAL RESPONSE PROTEIN
    2e-04  33%  2q0iA  [x.x.x] QUINOLONE SIGNAL RESPONSE PROTEIN
    2e-04  33%  3dh8A  [x.x.x] UNCHARACTERIZED PROTEIN PA1000
    2e-04  46%  2p4zB  [x.x.x] METAL-DEPENDENT HYDROLASES OF THE BETA-LACTAMASE
    2e-04  46%  2p4zA  [x.x.x] METAL-DEPENDENT HYDROLASES OF THE BETA-LACTAMASE
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
2zwrB           ----VFPVTLLQENAYLV---ETGEGPVIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVE
2zwrA           ----VFPVTLLQENAYLV---ETGEGPVIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVE
2gcuB           -------------------------ALLIDPDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKT
2gcuA           -------------------------ALLIDPDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKT
1xm8A           MQIELVPCLKD-NYAYILHDEDTGTVGVVDPS-EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKD
2p18A           --------------------------AAVDVNADYKPILTYIEEHLTTFSTILSTHKHWDHSGGNAKLKA
2p1eA           --------------------------AAVDVNADYKPILTYIEEHLTTFSTILSTHKHWDHSGGNAKLKA
2gmnA           --------------------------------GMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKK
2qedA           -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
1smlA           ---------------------------------------------------ILLSHAHADHAGPVAELKR
2qjsA           ---------------------------------------------------ILLSHAHANHAGPVAELKR
2qinC           ---------------------------------------------------ILLSHAHACHAGPVAELKR
2qinB           ---------------------------------------------------ILLSHAHACHAGPVAELKR
2qinA           ---------------------------------------------------ILLSHAHACHAGPVAELKR
1l9yA           ------PPFRIAGNLYYVGTDDLASYLIVTPRGDLEANVPMIKASIKKLKILLISHAHFDHAAGSELIKQ
1jt1A           ------PPFRIAGNLYYVGTDDLASYLIVTPRGDLEANVPMIKASIKKLKILLISHAHFDHAAGSELIKQ
2zo4A           ------------------------------------------------VKTILLTHHHPDHYGLSGGLGA
1p9eA           -----------------------------------------------QVDEIYITHMHPDHVGGVGEQLA
2q0jB           --------------------------------------LCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
2q0jA           --------------------------------------LCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
2q0iA           --------------------------------------LCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
3dh8A           --------------------------------------LCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
2p4zB           --------------------KKGNKEIVVDTGQSENFILMGIDVG--RIKKVVLTHGHYDHIGGKGLLER
2p4zA           --------------------KKGNKEIVVDTGQSENFILMGIDVG--RIKKVVLTHGHYDHIGGKGLLER


                         .         .         *         .         .         .         .:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
2zwrB           ALDLPVEGADLAARAWGLAIPK-------PPL----PVRPLEEGMRL-FGFQVL---HLPGHSPGHVAFY
2zwrA           ALDLPVEGADLAARAWGLAIPK-------PPL----PVRPLEEGMRL-FGFQVL---HLPGHSPGHVAFY
2gcuB           KL------PGVKS---VISKASGSKA-----------DLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYV
2gcuA           KL------PGVKS---VISKASGSKA-----------DLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYV
1xm8A           RYGAKVIGSAMDK----DRIPGI--------------DMALKDGDKWMFAGHEVHVMDTPGHTKGHISLY
2p18A           ELEA-MNVPVVVVGGANDSIPAVTK-----PVR---------EGDRVQVGDLSVEVIDAPCHTRGHVLYQ
2p1eA           ELVVVVGGAN-------DSIPAVTK-----PVR---------EGDRVQVGDLSVEVIDAPCHTRGHVLYQ
2gmnA           ETGAQLDKPLLEGGYYPGD--EKNEDLAFPAVKV---DRAVKEGDRVTLGDTTLTAHATPGHSPG-----
2qedA           HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
1smlA           RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
2qjsA           RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
2qinC           RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
2qinB           RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
2qinA           RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
1l9yA           QVSVILSGGKSDFHYANDS----STYFTQSTV-----DKVLHDGERVELGGTVLTAHLTPGHTRG-----
1jt1A           QVSVILSGGKSDFHYANDS----STYFTQSTV-----DKVLHDGERVELGGTVLTAHLTPGHTRG-----
2zo4A           RVFLHEEEFARGHRFW-----REPEAFAEASWRLFLPEETVEKGEALEVAGKRLRVLWTPGHADGHAAFY
1p9eA           FPNAVVRADQKEADFWLDKAP-DDESKGFPYVKAGKFKPFSGNTDLVPGIKALASHGHTPGHTT--YVVE
2q0jB           RLNVQVLASERTCQAWKSELRAEQRLWDALPVRAVADGEWLELGPRHR-----LQVIEAHGHSDDHVVFY
2q0jA           RLNVQVLASERTCQAWKSELRAEQRLWDALPVRAVADGEWLELGPRHR-----LQVIEAHGHSDDHVVFY
2q0iA           RLNVQVLASERTCQAWKSELRAEQRLWDALPVRAVADGEWLELGPRHR-----LQVIEAHGHSDDHVVFY
3dh8A           RLNVQVLASERTCQAWKSELRAEQRLWDALPVRAVADGEWLELGPRHR-----LQVIEAHGHSDDHVVFY
2p4zB           NPEVKI----------------------------------------------------------------
2p4zA           NPEVKI----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVxx
2zwrB           DPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASL-KRLLSLPPETRVHPGHGPGTTLGLEARTNPFL--
2zwrA           DPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASL-KRLLSLPPETRVHPGHGPGTTLGLEARTNPFL--
2gcuB           QPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDEVSTVGEEMQHNP----
2gcuA           QPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDEVSTVGEEMQHNP----
1xm8A           FPGSRAIFTGDTMFSLSCGK--LFEGTPKQMLASLQK-ITSLPDDTSIYCGH------------------
2p18A           HPNDGVALTGDTMFIAGIGA--FFEGDEKDMVYHIHKGNDYALDKVTFIPGHEYTSGF------------
2p1eA           HPNDGVALTGDTMFIAGIGA--FFEGDEKDMVYHIHKGNDYALDKVTFIPGHEYTSGF------------
2gmnA           ----------------------------------------------------------------------
2qedA           --SRPYLFCGDTLFSGGCGR--------------------------------------------------
1smlA           ----------------------------------------------------------------------
2qjsA           ----------------------------------------------------------------------
2qinC           ----------------------------------------------------------------------
2qinB           ----------------------------------------------------------------------
2qinA           ----------------------------------------------------------------------
1l9yA           ----------------------------------------------------------------------
1jt1A           ----------------------------------------------------------------------
2zo4A           LEEEGVLLAGDALLEPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIA--------------
1p9eA           SQGQKLALLGDLILVAAV----------------------------------------------------
2q0jB           DVRRRRLFCGDAL---------------------------------------------------------
2q0jA           DVRRRRLFCGDAL---------------------------------------------------------
2q0iA           DVRRRRLFCGDAL---------------------------------------------------------
3dh8A           DVRRRRLFCGDAL---------------------------------------------------------
2p4zB           ----------------------------------------------------------------------
2p4zA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xx
2zwrB           --
2zwrA           --
2gcuB           --
2gcuA           --
1xm8A           --
2p18A           --
2p1eA           --
2gmnA           --
2qedA           --
1smlA           --
2qjsA           --
2qinC           --
2qinB           --
2qinA           --
1l9yA           --
1jt1A           --
2zo4A           --
1p9eA           --
2q0jB           --
2q0jA           --
2q0iA           --
3dh8A           --
2p4zB           --
2p4zA           --